PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00986.1.g00300.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 203aa    MW: 22625.7 Da    PI: 10.0237
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00986.1.g00300.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.22.4e-301767151
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                                  kprlrWtp+LHerFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQ
  Zpz_sc00986.1.g00300.1.sm.mk 17 KPRLRWTPDLHERFVDAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQ 67
                                  79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6541474IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-291467IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-211767IPR006447Myb domain, plants
SuperFamilySSF466891.27E-131768IPR009057Homeodomain-like
PfamPF002491.8E-81968IPR001005SANT/Myb domain
PfamPF143793.3E-1081107IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MQGTYSGGMA ALSRDPKPRL RWTPDLHERF VDAVTKLGGP DKATPKSVLR LMGMKGLTLY  60
HLKSHLQDSL HKASVSPPQR LLVQKKLQMR IEAQGKYLKA ILEKAHKNIT FDANGSGNIE  120
STRSQLTDFN LALSGFVDNA THVYEENKGQ LVKAISNDID NHKDHHLSFR LYNAGSQEAK  180
DVKRTPETED TLLLDLNIKG GNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-181767151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-181767151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-181767151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-181767151Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00986.1.g00300.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1064008e-55AK106400.1 Oryza sativa Japonica Group cDNA clone:002-102-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021318852.12e-85myb family transcription factor PHL11
RefseqXP_021318853.12e-85myb family transcription factor PHL11
SwissprotC0SVS42e-43PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A0D9ZQ572e-86A0A0D9ZQ57_9ORYZ; Uncharacterized protein
TrEMBLQ7XPT22e-86Q7XPT2_ORYSJ; OSJNBa0083N12.9 protein
STRINGOGLUM04G23960.13e-87(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-39G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]