PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00986.1.g00220.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 751aa    MW: 81797 Da    PI: 9.8523
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00986.1.g00220.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.91.7e-23544587245
                           WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                    epgrCrRtDGKkWRCs+++ +++k+CErH++rgr+rsrk++e+
  Zpz_sc00986.1.g00220.1.am.mk 544 LEPGRCRRTDGKKWRCSKEAAPDSKYCERHMQRGRNRSRKPVEP 587
                                   69***************************************997 PP

2QLQ56.21e-19487522237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   ++T+aQ ++L++Q+l+yKyL+a++PvPpeLl++i++
  Zpz_sc00986.1.g00220.1.am.mk 487 PLTPAQYEELEQQALIYKYLLAGVPVPPELLVPIRR 522
                                   89********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-12486522IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.754487522IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-13487521IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.021543587IPR014977WRC domain
PfamPF088793.2E-20545586IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MLPGIQYNVQ RWSKESYVFQ VLLPHPWEGG ARNEMDGAET TCTSSLILTF PASDCRIRND  60
ATPRTYKDDD RASSPLFFSL PASIERKKNH VQLLPPRLGQ STGYWTDRSS AHICKSDVER  120
ICTKVFGELA DKETKLLDVG LLHLATLMVY NVLGFVARLV SSINKQLFGP HKDPPSLETV  180
NTRLKNDTFL AVRGTTADAL PLLGLQEYNV RGTKWITREE FQDLILTWVE KDLRLVFVNK  240
AAVAILGAPL LAISAKNAGR RVPRMEDAVD KVPTPLLAAV FSVGLLLLQD VQHGMHAASP  300
VQATARENLC LRSRAARTGC CQRGQRSMGP GMALSFCLCL RAQSFWTSSA RGKRSETTPK  360
DGKAKNRSGT AKRLAVSTPT MRPPPRLSGG HEWMAEGSMP PPGPSRVPAI LQTGSGTPIQ  420
AHMASRTGRA ERDNQRQASI DTAMPFASLS PATDHHPSSP STAPPLTPRE DAQRQQQQAM  480
SRRWPAPLTP AQYEELEQQA LIYKYLLAGV PVPPELLVPI RRGFVYHQPP LGYGPPYFGK  540
KVDLEPGRCR RTDGKKWRCS KEAAPDSKYC ERHMQRGRNR SRKPVEPQLV AAPISQPPAQ  600
ANLAGGCQNH TLYSAIAGSG SGAARRGGGA AGVHGLGSAA QMHMNNAAPY ATAAGGGSKD  660
LSYPLPLYGT LSGLDESTTS SLPKTERQPV SLFGSDFAKQ ENQTLRPFFD EWPKSRGSWS  720
ELADDNSLSS FSATQLSISI PMGTSTPAPD D
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00986.1.g00220.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158451e-113EF515845.1 Zea mays putative growth-regulating factor 6 (GRF6) mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-37growth-regulating factor 5