PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00970.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 488aa    MW: 50996.2 Da    PI: 9.7682
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00970.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.71.3e-28287336251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zpz_sc00970.1.g00020.1.am.mk 287 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 336
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-13284337IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-25285336IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-21287337IPR006447Myb domain, plants
PfamPF002492.1E-5288336IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MTAARTWTLP VAMGCHCCCR ERNKERQGCA RAIGARWDME ASSAASPDLS LHISLPNSSA  60
PGSGPAGGRA AAGGAGGGGV GGDPWRRLNW STELSLSPPA EPDADALPLR HRPSAAASSS  120
AATTSSARMM PMPTLQPLDA GGGGGGGGAS AAPPIRGIPI YNGPGGFPFL PPAAGGDHQK  180
VRFYGSYHHP ATWPSSLGST SPSPLAPGAS PLDPASAFLS PAVHHHHRML SASGRLNGML  240
TDTLRGYGSA GGLGGIGGHH HLHGAQPFGL GSRFMPKLPA KRSMRAPRMR WTSTLHARFV  300
HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQVRGC RPPLPLNSPK TRAFCFVYLL  360
PFLFLFGSDK NANAVTPELV NDGETDDGWR LAAKKLSFLG ERERERREKG PADGGSGDDE  420
FSGAGQTASG GDNNMCARPF GEHRSTSEGA ASSVGRGGDM DQSTAGNTST RWSNSSRYST  480
DLLFPKYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-14288336351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-14288336351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-14288336351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-14288336351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00970.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253981e-107EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546671e-107EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353566.11e-135uncharacterized protein LOC100280930 isoform 1
SwissprotQ0J2351e-83ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A1D6I3X21e-134A0A1D6I3X2_MAIZE; Milkweed pod1
STRINGPavir.J41082.1.p1e-134(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-35G2-like family protein