PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00950.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 360aa    MW: 38094.3 Da    PI: 9.3856
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00950.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.66e-22279331153
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  ls
  Zpz_sc00950.1.g00010.1.am.mk 279 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRWVCLS 331
                                   6***********************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-22273329IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.443277354IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-20278331IPR004333Transcription factor, SBP-box
PfamPF031102.1E-16280331IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
QLGPAEVSRI CRNPSSSPPL LVFSDLFFLP PALHIFPRRL SPALLPARII LPRERERGPC  60
WICRVAADGE RPALFRRCRR AADERQCTHG RTVRVSAVSV SAVSSSSAGP IPSTTAAIDR  120
SGDSSPVARV ASCLGSAPSS NDSSLHGDAV AAAGRGRGRG RPHPPTTFLM TLGLVCAPGE  180
LFLLGRRGSC DRPGGFSAHC SSLRSPNQPR IAQAESAMEW TVPKPAASPS SPPLLWDWGD  240
SAAPASGSSG EAPARRGGKE REGKRAKGGE DGGGGGEVRC QVEGCGLDLG GAKEYHRKHR  300
VCEAHTKCPR VVVAGQERRF CQQCSRWVCL SCCFQFPGRR SSAVDLVDPC RAASSRLSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A9e-14275327153squamosa promoter-binding protein-like 12
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00950.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626514e-49AK062651.1 Oryza sativa Japonica Group cDNA clone:001-105-E07, full insert sequence.
GenBankAP0057724e-49AP005772.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0073A21.
GenBankAP0149584e-49AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126104e-49CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4875223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-21squamosa promoter binding protein-like 2