PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00931.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 744aa    MW: 78261.1 Da    PI: 10.4915
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00931.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.3e-38453510360
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   ++ l+cprC+s+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk + 
  Zpz_sc00931.1.g00050.1.am.mk 453 QAPLPCPRCNSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKPRP 510
                                   66789**************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-31455509IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-25456507IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.357456510IPR003851Zinc finger, Dof-type
PROSITE patternPS013610458494IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MHGQTCVGRY EARHRPGPWQ GGSLLPAPVV RPSVRPSIFP ELRKRILRET DRRSMCSPLI  60
RVSACPDSDT EYYSRFPGRT KESANSAPML RGSKWVSAAF YPQVDTAAAC RRTRGPIEER  120
IPRPASSTDR LIAMTVAAAI PSPSLFPLSV RRFTALRLPA GPRALPLSSR AGVGPEQAVH  180
SAAAPCREGT SARLGLGWVG GLEQTRAQES GGRGAPAPHR ACLRGAPVAG MPHACFPRPA  240
SQPWESVIDD KHGADRPRPG KATRPDAVRP SFAGERIPNF LSAVYDMHAW PAEKAHPSTV  300
HTTRAGAGLK YAFFATSRQG PGCLLNAPAA ELDCHDHTLP VPGRPYPAAR FAGHAGRNVT  360
SPRRLSLRFP VSPSVTMIQE LLGGAAMDQL KSVNDGNPAS LPMLLHPIVA APSPTSSSST  420
SSRSSPQQPL PQRSTSATSS PQGQQQGQGA AEQAPLPCPR CNSSNTKFCY YNNYNLTQPR  480
HFCKTCRRYW TKGGALRNVP IGGGCRKPRP MPTPAAKPVM SCKGLGGGPQ LGLGVGMGMG  540
GASPVPWAPS QQTAAAQLMA LLSSARGMQG HGGSNVHRLL GLDSIGHLPL HVLPGTGNAT  600
GAPASLWPPS APRQVPATPA NMDSQLGMGP LGHNDVLSNL GLKLPPSSQS PAPNYYNDQL  660
HAVVSNAGRA REYDASATSL PCTTTVTSLP PAVSSISAAL SGATAGQLDL LPVSLTAPEM  720
QYWTGPAAMP VAWPDLPTPN GAFP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00931.1.g00050.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A368SE801e-154A0A368SE80_SETIT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.14e-30Dof family protein