PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00906.1.g00160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 191aa    MW: 19524 Da    PI: 8.8954
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00906.1.g00160.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof90.61.3e-2873130461
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   + l+cprC s++tkfCy+nny++ qPr++C+aC ryWt+GGalr v   ++ r++ +s
  Zpz_sc00906.1.g00160.1.am.mk  73 EPLPCPRCGSRETKFCYFNNYNVRQPRHLCRACSRYWTAGGALRCVTTASSGRRRPRS 130
                                   5789******************************************988766665444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-1973118IPR003851Zinc finger, Dof-type
PfamPF027012.8E-2574127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.02475129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MDADAAGFKL FGKVIQPPDA HQRTAEESVA TPPPPPPPPP ESMTPSQTLP TLPPSLPAAA  60
AAAAPSAAGG TGEPLPCPRC GSRETKFCYF NNYNVRQPRH LCRACSRYWT AGGALRCVTT  120
ASSGRRRPRS SAARSASAAA DAVAASASSA SAADERGARA CVTQCRPILP HASATGRPAC  180
GPAEPSCPFS T
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00906.1.g00160.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0616551e-62BT061655.1 Zea mays full-length cDNA clone ZM_BFb0169J01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001167867.24e-41uncharacterized protein LOC100381571
TrEMBLA0A1D6NG268e-40A0A1D6NG26_MAIZE; Cyclic dof factor 2
STRINGSb03g030850.16e-41(Sorghum bicolor)
STRINGGRMZM2G327189_P011e-40(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147161620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.13e-22Dof family protein