PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00883.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 442aa    MW: 48664.7 Da    PI: 7.4444
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00883.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.38.6e-221187278
                        DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
                                  CaaC++ r kC++dCv+apyf  e+ ++fa+++ +FGasnv+k+l++ +++er +a++ l+y A   +  P  G  +
  Zpz_sc00883.1.g00040.1.sm.mk 11 CAACRHIRWKCEPDCVFAPYFGPEDGEHFAVLEGVFGASNVSKVLADHDPHERVAAIKRLLYLAAENVLAPAGGRWS 87
                                  *******************************************************************9999998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.359110IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-201187IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MASSSEEAKV CAACRHIRWK CEPDCVFAPY FGPEDGEHFA VLEGVFGASN VSKVLADHDP  60
HERVAAIKRL LYLAAENVLA PAGGRWSSVP WGHGEKPPNQ QMAEAQQAAA TAQASREQAL  120
MMQCHSRTGF GVPAGHLPSC QATEIQQQQT AAAVVTNAWH QDMMMRQAAA AQNYQALGLQ  180
QQRQNQQLAE GVRHQNHHTA LTAEAAKRAT AADAARVREI DTHLQFLRQA AMEEQYMNRY  240
LRTMMQQTVA DGQQEHHQLR HDRAGQNDAM RRNAMLQRNI ARGLANRQNF DQHIKIQQQY  300
WEKELMMMQK AAANAPAMPG EQPQPQRQTG NAQFQKESSL LPREAGSGSG ARTIPLLPER  360
STNAEAFLVQ PRLQPQTVNS FGIIGSQVEP SLPPLPPSLA DVPRQQQNDG GNEEIQAESG  420
GAKMQPCAQV RNLVVFALGA NP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1611891290LOB family transfactor Ramosa2.1
5ly0_B2e-1611891290LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00883.1.g00040.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3636334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.48e-19LBD family protein