PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00876.1.g00200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 175aa    MW: 19006.3 Da    PI: 6.514
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00876.1.g00200.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.13.2e-081564554
                                  HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                           HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                                   +e+ErrR ++++    +L +llPk    +   ls    + +A  YIk L
  Zpz_sc00876.1.g00200.1.am.mk 15 RKEIERRRTQEMRRLCVKLASLLPKEHYSSRDTLSQLGSVDEAAAYIKRL 64
                                  589**********************54455555***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.821064IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.19E-41568No hitNo description
SuperFamilySSF474591.11E-81581IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.3E-81574IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.6E-41670IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-51664IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS516718.573121175IPR002912ACT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0016597Molecular Functionamino acid binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MTSSGSGTAP AAMERKEIER RRTQEMRRLC VKLASLLPKE HYSSRDTLSQ LGSVDEAAAY  60
IKRLKERVDA LHQKRSAAMG GGGASTSMAV TTSSDTGSEE RAAAAPVVEV RQHNDGSTLD  120
VVLISSAERP FKLHEVATVL EEEGAEIVNA NFSVTGQRIF HTIYCRTVHA ESEEC
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00876.1.g00200.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457514.23e-64transcription factor bHLH162
TrEMBLA0A1B6Q2F76e-63A0A1B6Q2F7_SORBI; Uncharacterized protein
STRINGSb03g008570.19e-66(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82936133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.12e-17bHLH family protein