PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00856.1.g00270.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family FAR1
Protein Properties Length: 477aa    MW: 52370.3 Da    PI: 5.252
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00856.1.g00270.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR125.15.9e-0831754989
                            FAR1 49 ekerrtraetrtgCkaklkvkkek....dgkwevtkleleHnHel 89
                                    ++er+  +     C a+++v  ++    +gkw+v+kl+ eHnHel
  Zpz_sc00856.1.g00270.1.am.mkhc 31 SDEREDASAAAERCSAMMEVVATDgaggKGKWKVSKLVVEHNHEL 75
                                    5678888889999******99988888999**************9 PP

2FAR126.32.4e-08102166248
                            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................t 48 
                                     fY eY+++vGF+ r+ ++++s ++ge + ++f C    ++++++k                   +
  Zpz_sc00856.1.g00270.1.am.mkhc 102 FYYEYGERVGFKARVGSNRRSVDDGEKIVQRFICWWGNYTNRRSKGkdsdegkeaeelveegddA 166
                                     9*********************************8776666666554555555555555555443 PP

3FAR136.81.3e-11377434161
                            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtg 61 
                                     +fY +YA ++GFsvrk    k+ +n  +++r +vCskeg+r+++  +  +++++r+e rtg
  Zpz_sc00856.1.g00270.1.am.mkhc 377 EFYVSYAGTAGFSVRKGWLDKTAKNV-TKSRVYVCSKEGFRSKSIVA--ESKKPRPEARTG 434
                                     6********************95555.99**************9988..788888888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-53175IPR004330FAR1 DNA binding domain
PfamPF031012.6E-5102161IPR004330FAR1 DNA binding domain
PfamPF031016.0E-9377434IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAGEAAAPAP GPEASAAPAN PPEPLPQSGA SDEREDASAA AERCSAMMEV VATDGAGGKG  60
KWKVSKLVVE HNHELRVAPG EVTATVPALG MEFDSVEDAK GFYYEYGERV GFKARVGSNR  120
RSVDDGEKIV QRFICWWGNY TNRRSKGKDS DEGKEAEELV EEGDDAARKR KREPNKRMNR  180
MPVTKTTEVI EFEKGVGMAG TGNGSASRKS RNKDLVENDG EPVDMEETHD GTADDEDDEA  240
GSEDGVDEEV QMVKEKRGMG RPKKAIRKND ARQALVLREL GLKASQYDNE ERKKILGKYL  300
SKRRSRPTAA RSTKPSQPSE RRSKRLERQN LKKEEEKAES KEEITEAEPD PETEVVAGPG  360
GEPKIGMVFV DEDKAYEFYV SYAGTAGFSV RKGWLDKTAK NVTKSRVYVC SKEGFRSKSI  420
VAESKKPRPE ARTGPPESEE IEIPLRVDPA TAPYVTQQFG LGSLQGFPGM SPFGQVT
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00856.1.g00270.1.am.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463799.11e-151protein FAR-RED IMPAIRED RESPONSE 1 isoform X2
RefseqXP_021318250.11e-151protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
TrEMBLA0A1Z5S4Q51e-144A0A1Z5S4Q5_SORBI; Uncharacterized protein
STRINGSb01g006380.11e-150(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148331318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.19e-09FAR1 family protein