PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00843.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 313aa    MW: 33881.3 Da    PI: 10.1878
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00843.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.8e-272069352
                       G2-like  3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                                  rlrWt+eLH+ Fv+av+ LGG++kAtPk il++m+v gLt++hvkSHLQ+
  Zpz_sc00843.1.g00040.1.sm.mk 20 RLRWTTELHHGFVRAVDCLGGPDKATPKLILQIMDVRGLTIAHVKSHLQR 69
                                  9************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.5371575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-251569IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-192069IPR006447Myb domain, plants
SuperFamilySSF466894.84E-132071IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGGGRNGAAT RRYNRSKVLR LRWTTELHHG FVRAVDCLGG PDKATPKLIL QIMDVRGLTI  60
AHVKSHLQRC NHGKQQYIRS THSPLMREEA PKSSCAYPRK GAEAAAATHE SMLQRNSDMG  120
APGTQRCSDD CMQAVSMGRS RRWTDQGIGW QRHAAASSTL QALGFWVRGY APFKISRPIV  180
NHISPVARQV SSKYISLEDR RFMFSIRDEP AERRSPSQSL DPEAVDAITS WHSVSSVVGV  240
PSPLPSSTNF SGCSGPSGGC FAGQKGKSTA AEAKAIAEAA SSATCIMPRC RTGCNLSSEN  300
SGTPSCPRPV ELN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-152069352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-152069352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-152069352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-152069352Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00843.1.g00040.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799208.15e-84uncharacterized protein LOC112879085
TrEMBLK3YZB71e-80K3YZB7_SETIT; Uncharacterized protein
STRINGPavir.Ab02674.1.p2e-82(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-24G2-like family protein