PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00802.1.g00200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 492aa    MW: 53081.5 Da    PI: 9.2867
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00802.1.g00200.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.31.6e-491422672128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgy
  Zpz_sc00802.1.g00200.1.am.mk 142 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGY 221
                                   79***************************.99***************7767789*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zpz_sc00802.1.g00200.1.am.mk 222 WKATGADRMIRGENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 267
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-57141291IPR003441NAC domain
PROSITE profilePS5100555.408141291IPR003441NAC domain
PfamPF023652.1E-24143267IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MHVLTCQRAR RSSSEREAAE ASTDRRQEFG RGSRPKLDSS WLVSFASLNP TTPPSPSTRQ  60
GSSRHKQLRS CDSCAQNHST TCTAALDFSS ILRVRASYAM SRDLEDGHGG AVAAGGGAGS  120
SEASVGGGAG DGGDSHDNDL VMPGFRFHPT EEELIEFYLR RKVEGRRFNV DLIADLDLYR  180
FDPWELPAMA VMGGKEWFFY VPRDRKYRNG DRPNRVTASG YWKATGADRM IRGENNRPIG  240
LKKTLVFYSG KAPKGVRSSW IMNEYRLPPP AADADPLTHK SEISLCRVYK RSGIDDGHGQ  300
PSSSTQASSG RRTRTSRHMS TSPASTPLSH IQHPGSFHLL QGECSSVSPP TIMDPLLAAH  360
NVPQLLQPPR PRALTGNSLA AGASVPTEGA AILASTYSLL NMAAVPMGSS RPVDELSTLV  420
GHSQAYANHL SAATGSHFVL PLPLPQPTPQ VAPLGALPMA APPLASVADK LSWDWNPVPD  480
TTARDYSNSS FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5514329219166NO APICAL MERISTEM PROTEIN
1ut4_B4e-5514329219166NO APICAL MERISTEM PROTEIN
1ut7_A4e-5514329219166NO APICAL MERISTEM PROTEIN
1ut7_B4e-5514329219166NO APICAL MERISTEM PROTEIN
3swm_A5e-5514329222169NAC domain-containing protein 19
3swm_B5e-5514329222169NAC domain-containing protein 19
3swm_C5e-5514329222169NAC domain-containing protein 19
3swm_D5e-5514329222169NAC domain-containing protein 19
3swp_A5e-5514329222169NAC domain-containing protein 19
3swp_B5e-5514329222169NAC domain-containing protein 19
3swp_C5e-5514329222169NAC domain-containing protein 19
3swp_D5e-5514329222169NAC domain-containing protein 19
4dul_A4e-5514329219166NAC domain-containing protein 19
4dul_B4e-5514329219166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587620.0HQ858762.1 Zea mays clone UT1609 NAC transcription factor mRNA, partial cds.
GenBankBT0604780.0BT060478.1 Zea mays full-length cDNA clone ZM_BFb0004F04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-172PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK3Z6L91e-172K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.13e-89NAC domain containing protein 35