PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00790.1.g00090.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 466aa    MW: 50892.1 Da    PI: 9.5149
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00790.1.g00090.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS249.81.1e-76614522374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetse.knsseelaal 81 
                                   +++++ c+ a++ g+   a+a+L+ +s  asp gd ++R+a+ f+eA a+r +   ++l  a++ +  +  ++ +   aa+
  Zpz_sc00790.1.g00090.1.sm.mk  61 KHVIMYCVAAIDMGNVMTASAALQSISSVASPLGDHLKRVAFTFAEAFARRAMWLLPGLTWAMQLQVPPLpMTPEAINAAR 141
                                   7899**************************************************9***99999776655404455555677 PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   + f  ++P+++++  + N+aIl a++ e++vH++D++  ++ QW+ L++ +a+R+++ppslR+ +v++    + + l++t+
  Zpz_sc00790.1.g00090.1.sm.mk 142 RSFAALCPLVRVAATAVNHAILGATAAERAVHVVDLGGANPNQWLELIRLFAARSRSPPSLRLSVVNE----EDDFLSSTA 218
                                   77******************************************************************....99******* PP

                          GRAS 163 erLakfAeelgvpfefnvl..vakrledleleeLrvkp.gEalaVnlvlqlhrll...........desvsleserdevLk 229
                                     L++ A +lgv+f fn++    ++++  ++++Lr+ + +Eal++ + lqlhrl            +e+  ++ + d++L+
  Zpz_sc00790.1.g00090.1.sm.mk 219 GLLTQEAVRLGVNFLFNPVrsNIDHFTPTDVSALRIVEgREALVITSTLQLHRLIadevtinlpgvAENNMIT-KADALLR 298
                                   ******************7444445666689999999999***************666666666644444444.59***** PP

                          GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerre 307
                                   ++++ +Pk+vv++eqea hn+e +  r+ +a++yy+alf  le++++  +    +r+ vEr+ll++e++++va  g  rre
  Zpz_sc00790.1.g00090.1.sm.mk 299 VLRDQKPKLVVLTEQEAHHNDEALKCRVKNAFDYYAALFHDLETGAGGLAsgvADRVAVERVLLRNEVMDIVAGDGVLRRE 379
                                   ******************************************99855444455**************************** PP

                          GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.....yrve.eesgslvlgWkdrpLvsvSaWr 374
                                   rhe+  +W  r++ aGF+p+p+++ + k+     +  ++ g     yr +  + g+++l+ ++ p++svS+Wr
  Zpz_sc00790.1.g00090.1.sm.mk 380 RHEKITRWLTRMTVAGFEPIPMTYGVIKETAIAAHLLSGSGsnmrmYRAQkVNTGCIFLYARKIPIFSVSVWR 452
                                   ***********************99888765555555444422223666634588999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.18834426IPR005202Transcription factor GRAS
PfamPF035143.8E-7461452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MNPEGSNNKK GKAVVVKKEP SSLPMLVDAA SPAVPPPLPA APMANIPRPH QYGENRSLFI  60
KHVIMYCVAA IDMGNVMTAS AALQSISSVA SPLGDHLKRV AFTFAEAFAR RAMWLLPGLT  120
WAMQLQVPPL PMTPEAINAA RRSFAALCPL VRVAATAVNH AILGATAAER AVHVVDLGGA  180
NPNQWLELIR LFAARSRSPP SLRLSVVNEE DDFLSSTAGL LTQEAVRLGV NFLFNPVRSN  240
IDHFTPTDVS ALRIVEGREA LVITSTLQLH RLIADEVTIN LPGVAENNMI TKADALLRVL  300
RDQKPKLVVL TEQEAHHNDE ALKCRVKNAF DYYAALFHDL ETGAGGLASG VADRVAVERV  360
LLRNEVMDIV AGDGVLRRER HEKITRWLTR MTVAGFEPIP MTYGVIKETA IAAHLLSGSG  420
SNMRMYRAQK VNTGCIFLYA RKIPIFSVSV WRPVMSEYPS FSLQHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-30604524375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-121hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-137K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m1e-137(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-55scarecrow-like 3