PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00777.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 588aa    MW: 61392.5 Da    PI: 6.9392
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00777.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.1e-24215258245
                             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                      epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Zpz_sc00777.1.g00040.1.sm.mkhc 215 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 258
                                     69***************************************986 PP

2QLQ60.35.5e-21148184137
                             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                     ++FT++Q+ +L++Q+l+yKyLaan P+Pp+Ll +i++
  Zpz_sc00777.1.g00040.1.sm.mkhc 148 GPFTPSQWIELEHQALIYKYLAANSPIPPNLLIPIRR 184
                                     59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.5E-12148184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.84149184IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-15149183IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65214258IPR014977WRC domain
PfamPF088794.9E-20216257IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MDLGGVVMAA VDAGGGAELG LLGGSSLLKH GRSDAAGGEG HGWGVRACKQ ARVADVSAAA  60
APFLLGSCSP GHGGEQMLSF SSAASSCPSI ASAAAAGGGG AAADVAVPLY YGTPASCSGE  120
DGDRRAPGGL SSVRLSTGMQ GAMARMRGPF TPSQWIELEH QALIYKYLAA NSPIPPNLLI  180
PIRRSLASPY SPAYFGTSTL GWGSFQLGYS GNADLEPGRC RRTDGKKWRC SRDAVADQKY  240
CERHMNRGRH RSRKHVEGQP GHAAKAMSAA VAAAATSATQ PGVLPASGAG ATVAGLTVNQ  300
HQQPVKNYAA GASDPCSLQY NREQMAKQNE SENMQESDNL SMLTSMNTRN NGSIFPFSKQ  360
NNPFEVSGSR PDFGLVSSDS LMSSHSSLEN VNLLSNEHQS SASLHHFVDW PRTLAQGGLA  420
WPDTKDMQAQ RTQVSVSAPI ASSELSSAST SPIHEKLMLS PLKLSREYSP VGLSIAANRD  480
EAGLVQGNWM FRDSSLGGPL GEVLTKNGNT EAMNCMSAPL NLLTDCWDSS PGLDSSPVEV  540
LQKTTFGSVS SSTGSSPRME NHGAYDGICN PPDDLGSVVV THPSIRLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00777.1.g00040.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795429.10.0growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLA0A2S3IIH70.0A0A2S3IIH7_9POAL; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.14e-47growth-regulating factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Liu H, et al.
    OsmiR396d-regulated OsGRFs function in floral organogenesis in rice through binding to their targets OsJMJ706 and OsCR4.
    Plant Physiol., 2014. 165(1): p. 160-74
    [PMID:24596329]
  3. Gao F, et al.
    Blocking miR396 increases rice yield by shaping inflorescence architecture.
    Nat Plants, 2015. 2: p. 15196
    [PMID:27250748]