PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00741.1.g00080.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 463aa    MW: 50179.9 Da    PI: 5.1142
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00741.1.g00080.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.14.5e-1457872555
                       G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  + A+Pk+il lm+v+gLt ++++SHLQkYR+
  Zpz_sc00741.1.g00080.1.sm.mk 57 DDAVPKKILALMNVNGLTTANIASHLQKYRI 87
                                  78****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011010.818133IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.4E-4641No hitNo description
Gene3DG3DSA:1.10.10.603.0E-135791IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-115787IPR006447Myb domain, plants
SuperFamilySSF466891.97E-75791IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MAPMLEGVKF GAADYILKPV HMAQVKSLWT HVVRKGRRYT SYYTNDAGQK SKPRVADDAV  60
PKKILALMNV NGLTTANIAS HLQKYRIYLR NHSVGTIRHS NPLSDESKWN EWGSNSNGSE  120
NFMRNSEIFQ GGSQLKDAAV SGSQQGVNQF TITFGKPHLN MSAEGKPFLS DPSGSTIANT  180
SNGIEFNSSN SLPSGSSGNM FGSISVDSLT QARSTGLPSY GSMWRQKILG ASRGIPVDDD  240
DDFQSIADGN ILAPNNLLRA QPPQLENQLS VQMQTYAHLS NGIAIEPSGF ASLSIITNTG  300
KTDALPEFDE LGYKDGPFKG PSQGNNLTIN QFFGYEATSG QMPNFGNEFQ NQIDTVMSEK  360
TIPNVGFSRQ MAPVNLERSR NSVVMPKDNY TLACAPNIIG TQPNIEDAIG NLPANDNTVC  420
LPDVADELMN NNGSLVGASE AHGMTDDLLD IDISEDCKKY ITF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00741.1.g00080.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3621934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.11e-16response regulator 10