PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00738.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 626aa    MW: 67844.4 Da    PI: 9.8937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00738.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.64.9e-12106134231
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPkt 31 
                                   prlrWtp+LH +Fv+ave+LGG+e  +Pk+
  Zpz_sc00738.1.g00010.1.am.mk 106 PRLRWTPDLHMAFVHAVERLGGQE-NVPKQ 134
                                   8*******************9998.58886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-10102134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MMMRGVTDQK QVLQVLDDDE EIRSMGNNAL DLNVDVVSEE GEVGDDDDED DGDGGSTTDA  60
AGSRSSSNNS STNKDSESKK GCGGEVEGSG EKRVPSVRPY NRSKLPRLRW TPDLHMAFVH  120
AVERLGGQEN VPKQEARPGR SPEGSMHSPM DFHFMRGERG FHGLSFLQRA AALSSSGPEH  180
GGFFASRNGG RTDFSRIYGL LQHHRQLQMQ SFDFRSSSFR RHERALNQWE EVITRKEVFK  240
PPSTSRPQPH HPLAPSPASI SSERRWWPFA DAGTAVAGEH TRVDTGQGAN FESSFGSNSR  300
PLSWVVSGDL HLPFRRRPGS GGSHVSNNTV MIRKPSDPVV IDEAPDDAQQ LERQEYVEPI  360
RGACRKRPLP EAQDSTAPEL QLSLSHSPTA AVDDAKKRKT AAAAGEQEVI HSSELSISLS  420
LWPPAAASMQ LQHPPREKTR GSTGSGSGEA VLGQSTLDLT MSIRALDPQL AEQPESEHPS  480
GPTGSLQRGP SIRPFQSAAA GAKSLSHLAR TPRDRIPNQK HLLPLSLPPA LINHLTRSPL  540
PSSPPHFHSP CSPPVHSRRR APVRRRRGVP AATRASARAG VASRHVTPTG QLPSIAPPNA  600
AVARARSIRA AFSVAGAGFW GRIGFD
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00738.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824409.11e-126uncharacterized protein LOC112899951 isoform X1
TrEMBLA0A2S3GN021e-124A0A2S3GN02_9POAL; Uncharacterized protein
STRINGSi016955m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-13G2-like family protein