PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00735.1.g00260.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 521aa    MW: 54496.8 Da    PI: 8.8035
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00735.1.g00260.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-3963124263
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                   kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Zpz_sc00735.1.g00260.1.am.mk  63 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 124
                                   7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3061121IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3365121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05967121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MEEMLMAGNP NPNQNQNPAP AAPSAPPGGA QRTGVPAASA AAPAAGAGTD AGAGTERRAR  60
PQKEKALNCP RCNSTNTKFC YYNNYSLQQP RYFCKTCRRY WTEGGSLRNV PVGGGSRKNK  120
RSSSSVSVAA ATTSAAMSGT VPVGVGLAAA KNPKLMHEGA QDLNLAFPHH NGRGLQPPEF  180
AAFPSLESSS VCNPAGAAMA GTGAGGRGVG AFSAMELLRS TGYYVPLQHM QLGMPAEYTS  240
AGFALGELRM PPPPQSQSVL GFSLDTHGTG GVGGPGAYSA ALQDSAAGRL LFPFEDLKPA  300
VSAAGGGVSN TVGDHQYEHS KDQGGDGRAA SGVTGGHQTP GFWNNSMIGN ASSNGSGGGP  360
WIYDCDERRQ HCSGQDERAV VMHVPVRTTV MYSGEQLGAC NQEQRRRFFT VSQPHSCPAD  420
TAIPADPGPG SGKARDRAVS CFGKGLVEQR RRSWPHGETA ETAVQISGPP AQVSVCTAWA  480
LAGWSDGGRR CYRVAWVILF DFIRKEAAFV GNWWRQVSLP I
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00735.1.g00260.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826521.11e-152dof zinc finger protein 2-like isoform X2
SwissprotB9F1L81e-119DOF2_ORYSJ; Dof zinc finger protein 2
TrEMBLA0A3L6QBV61e-152A0A3L6QBV6_PANMI; Uncharacterized protein
STRINGSb04g032040.11e-146(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.17e-43Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]