PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00703.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GeBP
Protein Properties Length: 454aa    MW: 48835.6 Da    PI: 9.6786
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00703.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57385.85.7e-27169263297
                        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfsk 82 
                                   +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+Kf+ +++++++g +p+  +
  Zpz_sc00703.1.g00090.1.am.mk 169 NFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKFRSMSARVANGLDPARLA 248
                                   79*******************.556878888************************************************** PP

                        DUF573  83 ehdqkifelskkiWg 97 
                                   +hd+++++l++++W+
  Zpz_sc00703.1.g00090.1.am.mk 249 PHDRDVLHLCSRLWD 263
                                   **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-24170263IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MEAGCRWEGV MSRIRNPRIP AEPTNPPRCD PSTRATQLDA IGLHHPYRVP SPSSPNPQAA  60
ATPSGHAARD PIHPPASHAT SPSRLVLVAP RGLASPARSP GSVRAMASHQ RTLPVPVPVS  120
PNPTAPADPT PPSSGARKLP IKRRSPRPST SSPRSSGSNQ QQQEQPPFNF QRIWSESDEL  180
RFLQGLLGCG AQGLVFPRDL NVFYDRFSES MPQPYTRSQL SEKLRRLKNK FRSMSARVAN  240
GLDPARLAPH DRDVLHLCSR LWDPANAATS PFAAGTGTGA SGNKRRRANP RGTPLLAPDA  300
SGDSNSHDFN GISFPGGSNG EDMFFIEQES GHLGNHEGAP LVADSTFSGI ALEQSQTVAS  360
VPIENHGIVN EMNGNHKLVV PCSNEQCMAN AVLDVFDECL REAKANGNLS SGNAQGSADG  420
SELAKRWRAQ RIDELLVLSR RLRLLVEDAT VAGR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00703.1.g00090.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352841e-144BT035284.1 Zea mays full-length cDNA clone ZM_BFb0053D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.11e-162probable transcription factor At3g04930
RefseqXP_021307245.11e-162probable transcription factor At3g04930
TrEMBLB6T7U51e-162B6T7U5_MAIZE; Uncharacterized protein
STRINGSb01g010570.11e-162(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.19e-10DNA-binding storekeeper protein-related transcriptional regulator