PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00697.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 397aa    MW: 40376.7 Da    PI: 9.4711
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00697.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.3e-39103163262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Zpz_sc00697.1.g00110.1.am.mk 103 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 163
                                   56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3887161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609107161IPR003851Zinc finger, Dof-type
PfamPF027012.2E-32107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWNQQQQ QQQAHHGQLP SAGGGGGGGG VEPHQHQQQH QLPPVPPPGA  60
LMAPRPDMAM AGAASAGGGP TGGSAVRPGS MSERARLANI PQPEPGLKCP RCESTNTKFC  120
YFNNYSLSQP RHFCKTCRRY WTRGGALRNV PVGGGCRRNK RSKSSKSNSS SAASASATAG  180
GTSSSTSSTT TGGGSAAATA AIMPPQAQLP FLASLHQFGG DHYSTGASRL GFPGLSSLDP  240
VDYQFRTGGG AGTAIGLEHW RLPQIQQFPF LNRSDGMPPP MPGIYPFDIE GGGDAAGFAG  300
QMLAGSKVPG SSGLITQLAS VKMEDNNPQS TAMTNSPREF LGLSGSLPFW SGGNGAGGNS  360
NNNGVGANGG GGGGAVGPGS SWVDLAGFNP SSSGNIL
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00697.1.g00110.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792577.11e-154dof zinc finger protein DOF2.4-like
TrEMBLA0A3L6SDN71e-159A0A3L6SDN7_PANMI; Dof zinc finger protein DOF2.4-like
STRINGPavir.Ia00290.1.p1e-146(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.23e-46OBF-binding protein 3