PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00688.1.g00050.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 109aa    MW: 12002.7 Da    PI: 8.7593
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00688.1.g00050.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof65.21.1e-202432162
                        zf-Dof 21 ynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  ynnys+ qP yfCkaC  yWt+GG+l  v vGg +rknk++s
  Zpz_sc00688.1.g00050.1.sm.mk  2 YNNYSMLQPWYFCKACGSYWTQGGSLHSVHVGGECRKNKRAS 43
                                  9**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088416.647141IPR003851Zinc finger, Dof-type
PfamPF027014.0E-16241IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-10240IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MYNNYSMLQP WYFCKACGSY WTQGGSLHSV HVGGECRKNK RASTLALSTS RSSITNKPHL  60
MPISSSTVEP QDFPNVATCS RQLCPMDRNP QEPPASLHAA VLIHPGILV
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00688.1.g00050.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289545.11e-15PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLA0A1D8RJ522e-15A0A1D8RJ52_ELECO; Dof transcription factor family protein (Fragment)
STRINGXP_004289545.15e-15(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.38e-15Dof family protein