PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00661.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 819aa    MW: 88749.7 Da    PI: 10.3342
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00661.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.72.2e-37542597661
                        zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                    +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Zpz_sc00661.1.g00140.1.am.mk 542 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 597
                                   58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-37524596IPR003851Zinc finger, Dof-type
PfamPF027012.9E-31542596IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.854542596IPR003851Zinc finger, Dof-type
PROSITE patternPS013610544580IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MIILLLLHSE LAGLSRSLLS LWIPVPVHQH GDTYVTMVGI DYYAQQIPES RRFISRRPRT  60
KSQRIACPCL SAPTDPSVQV LHVSDQSVRG RSTWQRVAVT SHDASPRAVR TTRKRTCRHA  120
AFRRGHVPGA GRSSIHGPIG GSAPALNRVL VRYDWTAQLA AGHAGFTASR RSIGRSDGGL  180
DSLPPGASKS NLLLMPPCCP SKKYRPTYPL SPSTDDLPRQ LPENLLRVAD GAVLSASHGP  240
RWRSPVRTVR ADGLDAAGTG RSALRSGVVT SRALASCALV VPIRSLGSTG TELQRLVMSR  300
HELFKYSYVL YSKPLHVSVV VLSRLAMSGY CTRLAQLAGW STRHTAPGAI PGDIRRPVGL  360
AATARRTPRG ASLITRIHDR SSSCVAGASP SYPSKKSEAR TTDGRPPRES KNKWPWAIPR  420
DLRPSHPTGP WDLGLHAPVQ WGAATYVRRA RTIQPRRDAR RACVRAYARV RAFSAVSRPS  480
VTWPRGLRRT DHVHRRPPAL SNHAREDKEM LSSHPEAMMP YAPRPPSLLV DRRYKQGAEV  540
APNCPRCDSP NTKFCYYNNY SLSQPRYFCK GCRRYWTKGG SLRNVPVGGG CRKNRRGKSS  600
VRSAAESIAG GRDAAFGNRF PGPVRPDLVL EGMVGNAVNP GQATPDVQSS GDGSRIDLAM  660
LYAKFLNHPP ADAGATPESA GQMDEVFDTF SASTSDLSPA GVLGPGAQLD PCHDGFGEWS  720
GPVSSNDPTS TSSTTTTTTM LCTDVSVQAA LGELNFAMDQ SCFDALGLPA DVGNLSSWCS  780
IVPSLSTLDV ALSFHEGMIN GPDHDWSVDC QELEALYMP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00661.1.g00140.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-37Dof family protein