Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 400aa    MW: 44450.3 Da    PI: 11.5212
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                   + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Lea N  L  e ee 341 AMQRQKRMIKNRESAARSRERKQAYIAELESIVTQLEADNAVLLREQEERH 391
                                   679*************************************98877766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-5339397IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117341389IPR004827Basic-leucine zipper domain
PfamPF001702.6E-12341393IPR004827Basic-leucine zipper domain
CDDcd147078.31E-18343393No hitNo description
SuperFamilySSF579591.29E-9343392No hitNo description
Gene3DG3DSA: hitNo description
PROSITE patternPS000360346361IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.18e-26G-box binding factor 4