PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00661.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 400aa    MW: 44450.3 Da    PI: 11.5212
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00661.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-13341391353
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                   + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Lea N  L  e ee  
  Zpz_sc00661.1.g00010.1.am.mk 341 AMQRQKRMIKNRESAARSRERKQAYIAELESIVTQLEADNAVLLREQEERH 391
                                   679*************************************98877766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-5339397IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117341389IPR004827Basic-leucine zipper domain
PfamPF001702.6E-12341393IPR004827Basic-leucine zipper domain
CDDcd147078.31E-18343393No hitNo description
SuperFamilySSF579591.29E-9343392No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-12344390No hitNo description
PROSITE patternPS000360346361IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
RHPGRSTAEV WRVRGSNRPS RRLALRTVDR RCRCMDSDQW MNETLDCQVC EVCDGRRRVR  60
VRHVAFNAFN SAKLVARARL FIGRSLISRT FSLAASWFAD AFLVAPRSRW ILDWTATAPR  120
TRRAPRKPDA LRPPSHRRSR PKEKRFPVPA VHGARQPDTR TIGCKPQGTA TGQREEDAGD  180
LSSYLFATFS YATPVTRKRS EENNPAGRRG RCVQRGAPNP RRSQVGNHAT NLAAPHSPED  240
STSREVWKDI TGRGGSAGAA VPTASAPVVV AGGGAGTTTE MTLEDFLARE GAVKEDEVGI  300
PGPSAPVEGQ VAMGFFSGLE TVTGSGRGRK RQLIDPVDRA AMQRQKRMIK NRESAARSRE  360
RKQAYIAELE SIVTQLEADN AVLLREQEER HKKRLKEVIF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00661.1.g00010.1.am.mk
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.18e-26G-box binding factor 4