PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00650.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 127aa    MW: 13651.3 Da    PI: 4.7456
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00650.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.71.6e-1396742100
                        DUF260  42 vlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                   v   +++lp eer +a+++++ eA +r+rdPvyG++g+i +lqq+++ ++ ela++++e
  Zpz_sc00650.1.g00080.1.am.mk   9 VRARMQSLPVEERARAADTMAAEALWRVRDPVYGSAGIIDRLQQEIRAVQRELATTRAE 67 
                                   677899************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.561168IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-11865IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MSAPFDSAVR ARMQSLPVEE RARAADTMAA EALWRVRDPV YGSAGIIDRL QQEIRAVQRE  60
LATTRAELAM RAGTVAARTA GAQRAPATTP QPPAVEVRDG GHPLAVQHGE EEAPVLDPDA  120
FLNLDDL
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00650.1.g00080.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444738.25e-26LOB domain-containing protein 24
TrEMBLA0A3L6RJR89e-28A0A3L6RJR8_PANMI; LOB domain-containing protein 24-like
STRINGPavir.Cb01140.1.p4e-29(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562