PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00634.1.g00100.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 510aa    MW: 55106.3 Da    PI: 7.5887
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00634.1.g00100.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74.1e-31110163255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL ++hvkSHLQ+YR+
  Zpz_sc00634.1.g00100.1.am.mk 110 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLNIAHVKSHLQMYRS 163
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-29106164IPR009057Homeodomain-like
PROSITE profilePS5129412.49106166IPR017930Myb domain
SuperFamilySSF466891.11E-13109164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-21110165IPR006447Myb domain, plants
PfamPF002498.4E-8111162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MGDVKEKAVV EILEDDEKRS WRNSLPPVVL DLNESFLAEG SEDGDEVEED DDGGSTSEVA  60
GACRSSSNNS STNHNSGSNK NNDISSSSSK AEGSGERVPT VRPYNRSKLP RLRWTPDLHM  120
AFVHAVERLG GQERATPKLV LQMMNVRGLN IAHVKSHLQM YRSKKLDHES GHERAGISSV  180
FSPMDFHMRR GDRRFHDMFL QRAAGSALSS SLLQNVGFFG SRNAVSPEAS RIYGLLHRRQ  240
AATQTFDFKN YSSLRNQELA FNHHAASVTA GAITSDHGPA KGLIHNMIFR KDDKPTSHLF  300
DVRDAIAPNP PAVVTGAADR SSNWVGSSSR PLSRTMSASA STGFALGSHH LLSRWRGAGG  360
GNGYHLNGDV NTTSSDPVVT TDALGARLEK HLEPKAPNKV IDEMCTATGE KRTKILMEEN  420
SCTPDLQVGL SPDNNGAEAE KAKKRKVALS EKVVDNDKIP LLSLSLSLRS GEGSGGDAGS  480
RLEADSSSSN RKAALGLSTL DLTMSIKTLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-18111165357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-18111165357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-18111165357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-18111165357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00634.1.g00100.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812252.10.0uncharacterized protein LOC112889712
TrEMBLA0A2T7DXS00.0A0A2T7DXS0_9POAL; Uncharacterized protein
STRINGPavir.Db01175.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein