PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00621.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 507aa    MW: 54450.8 Da    PI: 10.2456
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00621.1.g00210.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.41.4e-37320376561
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ ++
  Zpz_sc00621.1.g00210.1.am.mk 320 GDPCPRCESRETKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSSSA 376
                                   578**************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-23320370IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.612321375IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31322374IPR003851Zinc finger, Dof-type
PROSITE patternPS013610323359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MQKPISGEST TPPCSGGGGG VAHVTCSPPP RDPTPAARAS ARWPPFLRHT AVPHWSLVAS  60
NRPPRLLGDH RQQSMALNQS ILFNQWPVLV TLRRAAVSRR VADVTAPPSE ERTAQFHHVQ  120
WSGWRRAVDG LHPQTQHYST DVWDRSWGLD QWVTVVDPWC TRTRTAPPGT GHIFLGSSHA  180
NRSIAGGRCA AVKCALTRAP GAQLTGSPVS HRLTVHPLTR RPDGKSESRA NQPDLLQQRG  240
AGVHKLERDR RDHERSSAQL CDTNASPASA LCSLAPPAAP RMQEPTRRPA PPFAGVDLRR  300
PKGYPEPATV KVEEAPATAG DPCPRCESRE TKFCYYNNYN TSQPRHFCKS CRRYWTKGGS  360
LRNVPVGGGT RKSSSASPAS PKNPKRSKNS KRRRVAPSPD PVPSTDDAVA SNAGVGNREP  420
TPAPLTEDAA AGNVEDRAHV APPAAEQGFK STSVARGLGV TDAGGGGGKE PPDTGPFEWP  480
SSCGDLGSFW GAGVFTDTDQ ALFLNLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1390394KRRRV
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00621.1.g00210.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541497e-73AK354149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005F20.
GenBankAK3609347e-73AK360934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1128K17.
GenBankAK3770587e-73AK377058.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3146P05.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-26DOF zinc finger protein 1