PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00595.1.g00280.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 351aa    MW: 37533.2 Da    PI: 8.9361
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00595.1.g00280.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32164217255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Zpz_sc00595.1.g00280.1.sm.mk 164 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 217
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15162218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28162217IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23164218IPR006447Myb domain, plants
PfamPF002491.8E-7165216IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPVSK PMDLGFWKRA LDSTPVATST PAATAAATTS PSSMAIASPA  60
PTGVGGFHPG AGAVHHQGAL PFVHHTQPIL PGSSGLRDLA SMRPIRGIPV YNASQAPLPF  120
LQSHPHSHQQ HCYDAIVGGV AWSRSPKAAL RLAGAPVKRG ARAPRMRWTT SLHARFVHAV  180
ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTIKT TDHRPASASC YGQAAAKTVI  240
DIFDDNQFDV SNTTSRSESS PQQSNPDNAN EHGSSMCALW SNSSMSRGAC FQLDKSSKDA  300
APSDIKSFED VQSRSLDDAF DLQNSSSPFQ ATGTLISGRK KPNLDFSLGP I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17165219357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17165219357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17165219357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17165219357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17165219458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00595.1.g00280.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369116e-94BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds.
GenBankKJ7268296e-94KJ726829.1 Zea mays clone pUT3369 G2-like transcription factor (GLK47) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025811930.11e-153probable transcription factor KAN2 isoform X2
TrEMBLA0A1E5VN241e-154A0A1E5VN24_9POAL; Putative transcription factor KAN2
STRINGPavir.Aa01011.1.p1e-146(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.12e-44G2-like family protein