PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00580.1.g00150.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 189aa    MW: 21419.8 Da    PI: 4.8918
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00580.1.g00150.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof70.91.9e-22100136238
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrr 38 
                                   ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+r
  Zpz_sc00580.1.g00150.1.sm.mk 100 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQR 136
                                   7899********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2186136IPR003851Zinc finger, Dof-type
PfamPF027013.8E-18102136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088418.576104158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MKVDTPQEEE DNMKVDAPEE EKETEMKVDV QHEKEVKEMN VNAQQEMENV GLGKPATLDH  60
KKDNKEQMDN AEDKAEPDPK GENGKTANDE SSQDKTLKKP DKILPCPRCN SMDTKFCYYN  120
NYNVNQPRHF CKNCQRGLQY QLSSMDKLTH DATLKTSGTS ISLPYHATCA LGLLVGMASH  180
NMEHTVDQN
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00580.1.g00150.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2995553e-60KF299555.1 Miscanthus sinensis clone Msin_IGR001_2 genomic sequence.
GenBankKF2995563e-60KF299556.1 Miscanthus sinensis clone Msin_IGR001_3 genomic sequence.
GenBankKF2995583e-60KF299558.1 Miscanthus sacchariflorus clone Msac_GC_5 genomic sequence.
GenBankKF2995593e-60KF299559.1 Miscanthus sacchariflorus clone Msac_GC_6 genomic sequence.
GenBankKF2995613e-60KF299561.1 Miscanthus sinensis clone Msin_Gol_8 genomic sequence.
GenBankKF2995623e-60KF299562.1 Miscanthus sinensis clone Msin_Gol_9 genomic sequence.
GenBankKF2995653e-60KF299565.1 Miscanthus sinensis clone Msin_Sil_12 genomic sequence.
GenBankKF2995673e-60KF299567.1 Miscanthus sinensis clone Msin_Wk_14 genomic sequence.
GenBankKF2995693e-60KF299569.1 Miscanthus sinensis clone Msin_Zeb_16 genomic sequence.
GenBankKF2995703e-60KF299570.1 Miscanthus x giganteus clone Mgig_Gig_17 genomic sequence.
GenBankKF2995713e-60KF299571.1 Miscanthus x giganteus clone Mgig_Gig_18 genomic sequence.
GenBankKF2995753e-60KF299575.1 Miscanthus x giganteus clone Mgig_Gig_22 genomic sequence.
GenBankKF2995773e-60KF299577.1 Miscanthus x giganteus clone Mgig_Gig_24 genomic sequence.
GenBankKF2995783e-60KF299578.1 Miscanthus x giganteus clone Mgig_Gig_25 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618265.13e-55cyclic dof factor 2
TrEMBLA0A1D8RJ042e-60A0A1D8RJ04_ELECO; DNA-binding with one finger protein 15
STRINGOGLUM01G11690.11e-54(Oryza glumipatula)
STRINGORUFI01G11230.11e-54(Oryza rufipogon)
STRINGOS01T0264000-016e-55(Oryza sativa)
STRINGONIVA01G12770.11e-54(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1972522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-28cycling DOF factor 1