PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00562.1.g00180.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 349aa    MW: 39059.2 Da    PI: 10.5761
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00562.1.g00180.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.83.2e-22262305245
                           WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   aepgrCrRtDGKkWRCsr++++++ +CErH++rgr rsrk++e 
  Zpz_sc00562.1.g00180.1.am.mk 262 AEPGRCRRTDGKKWRCSRDAVGDQRYCERHINRGRYRSRKHVEG 305
                                   79***************************************986 PP

2QLQ57.15.3e-20212248137
                           QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++
  Zpz_sc00562.1.g00180.1.am.mk 212 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIKR 248
                                   59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-12212248IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.308213248IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-13213246IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.486261305IPR014977WRC domain
PfamPF088796.7E-19262304IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MFQISVAFPH HLRVLYQHGR DPTRSRSSES PLTLPLTSAS NGSRPRCVSW CGDGAAGAFF  60
FLLFCWIRCH QLRWTADAEL FLLQWMRSCD RLSLLMGGHG SRSAKAPPFG SCQERKGRDA  120
YYSPSPFAFS ATPQDASCPQ RFNLSSFDLP RTFSAAQKDK GVTGVSCFLK IHHVWVLGNQ  180
WLARDTVSFS SNWLGLSSGA SNMQGVLSRV RGPFTPTQWM ELEHQALIYK HFAVNAPVPS  240
SLLLPIKRSF NPWGTFGSSS YAEPGRCRRT DGKKWRCSRD AVGDQRYCER HINRGRYRSR  300
KHVEGQKATP SNAGQAMAVS TTSNTVAWQQ QLKCSAANAT NPFPRESNR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00562.1.g00180.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-44growth-regulating factor 2