PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00559.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 493aa    MW: 51270.3 Da    PI: 8.5685
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00559.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.55.2e-37144202361
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   e  lkcprCdstntkfCy+nnyslsqPr+fC+aCrryWt+GGalrnvPvGgg r++ k+
  Zpz_sc00559.1.g00080.1.am.mk 144 EPGLKCPRCDSTNTKFCYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 202
                                   56789************************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-38127199IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31147201IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.789147201IPR003851Zinc finger, Dof-type
PROSITE patternPS013610149185IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MAPEKSLSPS PSQLIPPAIP ELLLLLLRSF SPSSQPHHKQ EGKAAPMRDR AMEGIHKPYT  60
MIFPPAFLDS SSWNDNQQQQ QAHHQQVVAS PGDGTSHEQL LQPSIMGGGA LPPEGGGTAQ  120
VVVGPAKPMS MSERARLARI PLPEPGLKCP RCDSTNTKFC YFNNYSLSQP RHFCRACRRY  180
WTRGGALRNV PVGGGYRRHA KRAKPKAAAA AAATPVTTAA ATAVLAPGAA AGSTSSTCTT  240
ANAPALFGQT AMLGGGNLSM LPPLLRLADF DAMSLGSSFT GIGKPTLDAV GNYSIGGASG  300
VEVAPTDARL PIPXXXNLSM LPPLLRLADF DAMSLGSSFT GIGKPTLDAV GNYSIGGASG  360
GAGAGAGLDQ WRWHQQMQGF PFQHAMDQGS LAPSLAMVMP GAFQLGLDNT DSRGAGTGGG  420
EDGSGEINGM APTKREGGYT RGMYGAHHHF TAGYTTSYFN ATGLGEDPTR LPAPAGPSLL  480
IASPALFSLW EGE
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00559.1.g00080.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0793561e-100AC079356.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0016H04, complete sequence.
GenBankAK1089331e-100AK108933.1 Oryza sativa Japonica Group cDNA clone:002-153-A09, full insert sequence.
GenBankAP0149611e-100AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ1835521e-100GQ183552.1 Oryza sativa Japonica Group Dof-type zinc finger protein 25 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700432.13e-86dof zinc finger protein DOF3.6 isoform X3
TrEMBLA0A1E5V0E74e-88A0A1E5V0E7_9POAL; Dof zinc finger protein DOF3.6
STRINGSi022547m9e-85(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.18e-40OBF-binding protein 3