PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00553.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 109aa    MW: 12313 Da    PI: 8.2578
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00553.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.98e-253897261
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                                  Fl+k+y++++d++++ ++sws ++nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y+
  Zpz_sc00553.1.g00040.1.sm.mk 38 FLTKTYDMIDDPTTDAVVSWSCTNNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTYE 97
                                  9********************888***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-263297IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.0E-2434109IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.36E-233697IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000563.6E-163861IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.2E-213897IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.6E-167688IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.6E-1689101IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MNHRMVNPVK VESQQSLGAA NGHPLPMDGL HDGGPPPFLT KTYDMIDDPT TDAVVSWSCT  60
NNSFVVWDPH IFGTVLLPRY FKHNNFSSFV RQLNTYEKRG HCKADLVKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B1e-1836992790Heat shock factor protein 1
5d5v_B1e-1836992790Heat shock factor protein 1
5d5v_D1e-1836992790Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00553.1.g00040.1.sm.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0920761e-46AC092076.7 Oryza sativa chromosome 3 BAC OSJNBb0021G19 genomic sequence, complete sequence.
GenBankAK0686601e-46AK068660.1 Oryza sativa Japonica Group cDNA clone:J013162K14, full insert sequence.
GenBankAP0149591e-46AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCT8293611e-46CT829361.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI220A14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981438.26e-56heat stress transcription factor A-2e
SwissprotQ6F3885e-55HFA2E_ORYSJ; Heat stress transcription factor A-2e
TrEMBLK4AC791e-54K4AC79_SETIT; Uncharacterized protein
STRINGPavir.J04151.1.p3e-57(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30837231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.13e-38heat shock transcription factor A6B
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]