PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00552.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 604aa    MW: 68082 Da    PI: 4.667
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00552.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS249.41.4e-762485793332
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lL++cA+av++++++ a +lL+++++ as +g+++qRla +f+++L+arla+++++l +    ++ s   ++e l a++l
  Zpz_sc00552.1.g00050.1.am.mk 248 TLLTHCAQAVAANNHASAWQLLNQIKQDASTTGNATQRLARCFAKGLEARLAGTGTQLWQFRMGEPPS---TVEYLEAYQL 325
                                   68***************************************************999999766666665...99******** PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQ..WpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   ++ v+ + k++     ++I++ + g+++vHi+D+++ + +Q  W+ Ll+ La+R++g+p+++iT++++p +    +e++ee
  Zpz_sc00552.1.g00050.1.am.mk 326 YVSVCSFDKVALCFSVKTIVDTIVGKSKVHIVDYGLDYAFQlrWAGLLELLANREGGSPEVKITAINHPGHWfyPAEQMEE 406
                                   ***********************************99998888*************************99889******** PP

                          GRAS 161 tgerLakfAeelgvp.fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkv 238
                                   tg+rL+k A+elg++ f+f++ + k++ed+ +++L+++++E+l+Vn +++l +l+desv  ++  +rd+vL+ + +++P v
  Zpz_sc00552.1.g00050.1.am.mk 407 TGSRLHKWAAELGLRyFKFHT-IRKKWEDVCIQDLDTESNEVLIVNDHFNLSTLMDESVFFDDpcPRDAVLSNIVKMRPAV 486
                                   **************77*****.7************************************9999999*************** PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                                   v+    ++ + ++sFl rf  al yy+alfd+l+a++pres++r+++E+el+g ++vn++a eg + ++  e++ +W++r 
  Zpz_sc00552.1.g00050.1.am.mk 487 VIQNVVNCTY-GTSFLSRFRGALFYYMALFDMLDATIPRESKQRVVLEQELFGGHAVNAIASEGVNVVQHPEKYTQWQARN 566
                                   **99999999.679******************************************************************* PP

                          GRAS 320 eeaGFkpvplsek 332
                                   ++aG  p+ ++++
  Zpz_sc00552.1.g00050.1.am.mk 567 QRAGIDPLDFTTT 579
                                   ******9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.059220601IPR005202Transcription factor GRAS
PfamPF035144.7E-74248579IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MTPTPEEFFV HCLMEQSPPS PSLCPDLPSL PDAYGEGWLF PNEMMLPHIS RMLMEDDTEE  60
KLSDDPALLR VQQPFAEILF DPSFGTDMGN NVNRRGNTEG PMDLMQDGSC YQMTAESAFA  120
KGADAVGAFL RGMEEAKTFL PKYGSFREDD LVSQLFREST NHGGPRTNNS KDDLLEAAVS  180
MTDEPMTMTK EQAERDDASE MLDGMMLQGW EKFVRDMEKL RITMANEAEE DRRKDRSNTA  240
RVVVDLPTLL THCAQAVAAN NHASAWQLLN QIKQDASTTG NATQRLARCF AKGLEARLAG  300
TGTQLWQFRM GEPPSTVEYL EAYQLYVSVC SFDKVALCFS VKTIVDTIVG KSKVHIVDYG  360
LDYAFQLRWA GLLELLANRE GGSPEVKITA INHPGHWFYP AEQMEETGSR LHKWAAELGL  420
RYFKFHTIRK KWEDVCIQDL DTESNEVLIV NDHFNLSTLM DESVFFDDPC PRDAVLSNIV  480
KMRPAVVIQN VVNCTYGTSF LSRFRGALFY YMALFDMLDA TIPRESKQRV VLEQELFGGH  540
AVNAIASEGV NVVQHPEKYT QWQARNQRAG IDPLDFTTTK FTLEFVLHAH RSSSDEDMLA  600
ACHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-292505778329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-81GRAS family protein