PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00514.1.g00170.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 375aa    MW: 39176.8 Da    PI: 5.6622
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00514.1.g00170.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.99e-311182096103
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                                    rh ++hTkv+gR+RR+Rl   caar+  L++eLG++ d++t+ WLlqq++pa++++tgt++ +a ++ +++ +       
  Zpz_sc00514.1.g00170.1.am.mk 118 PRHRDRHTKVEGRGRRIRLAEACAARIARLTRELGHKNDGETVRWLLQQSEPAVIAATGTGTVPAIAT-TVDGVLRLP--- 194
                                   69**********************************************************88777333.333333333... PP

                           TCP  87 sgkaaksaakskksqks 103
                                     ++ ++a    ++q +
  Zpz_sc00514.1.g00170.1.am.mk 195 --SSPPAAVADGDQQPD 209
                                   ..222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-24120189IPR005333Transcription factor, TCP
PROSITE profilePS5136921.52120174IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0031347Biological Processregulation of defense response
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MVQKIIETEQ KSKSRTRPKT GAAKSKQRRR IEEAGARDES ASSPNPISLG VAAPDMGEED  60
VAAIYHAAGN GTAVTDEAVV GIDAMGSSEA HGSLMPKPEP APMEFLGELQ VANPRPAPRH  120
RDRHTKVEGR GRRIRLAEAC AARIARLTRE LGHKNDGETV RWLLQQSEPA VIAATGTGTV  180
PAIATTVDGV LRLPSSPPAA VADGDQQPDP KRRRKLQPTR AAAAGATAPP LTSTPTAYYP  240
VVADPLLQGN GGGAISTSSG LAPASVPTPP PGAIPFLAIP APGPGATIDG KQMMKPTAVW  300
MVPPQAGAGG AANQPTHYWA FPTNPELFSN FQQQAVYDAG QLVDGGESQH QQLEGHQDGE  360
GEEEDIALTE SSSEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209215PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00514.1.g00170.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.11e-133transcription factor PCF2-like
SwissprotA2YXQ11e-80PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-80PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A2S3H1F51e-132A0A2S3H1F5_9POAL; Uncharacterized protein
TrEMBLA0A2T7EUU11e-132A0A2T7EUU1_9POAL; Uncharacterized protein
STRINGSb02g030260.11e-124(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.23e-37TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]