PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00389.1.g00130.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 432aa    MW: 47304.8 Da    PI: 7.028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00389.1.g00130.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.33.4e-28166220156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k +++Wtp+LH+rFv+aveqL G++kA+P++ile+m+++gLt+++++SHLQkYR++
  Zpz_sc00389.1.g00130.1.am.mk 166 KRKVDWTPDLHRRFVQAVEQL-GIDKAVPSRILEIMGIEGLTRHNIASHLQKYRSH 220
                                   5799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.937163222IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-27164223IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-27166220IPR006447Myb domain, plants
SuperFamilySSF466891.34E-17166223IPR009057Homeodomain-like
PfamPF002494.6E-8169218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MLEVLRSPGS KAADQLHVVD AGFPTSTDQC GSGGDEFMLD GENLLDYIDF TCCDVPSFFD  60
ADGDILPDLE TELLAEFEDH ERGGGKPPDD VASSSQGDHH HHKEDEERLL LQVEEEEGQT  120
AQTKKSGSGD EVSLASAVTS TDTSKSSSAS AEKKKKKKRS KNSNGKRKVD WTPDLHRRFV  180
QAVEQLGIDK AVPSRILEIM GIEGLTRHNI ASHLQKYRSH RKHLMAQEAE AASWAKKRQI  240
YAAARGAPRL TKDMPPAAAA PWVVRTTIRL PSPPFGRPLH VWGHPSTAVE ATAAPMLPVW  300
PRHLAPVDRA YWHQPPYNGA RTWGPMTQGT PCVPPPIMPR FPTPPVPGTM MPHPMYRPPM  360
PPPPQITASN VATLQLRLDA HPSKESIDAA IGDVLAKPWL PLPLGLKPPS LDSVMSELHK  420
QGIPKIPPSS YL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A9e-16171222657Transcription factor LUX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152158KKKKKKR
2154161KKKKRSKN
3154167KKKKRSKNSNGKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00389.1.g00130.1.am.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535712e-51AK353571.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1001B16.
GenBankAK3535752e-51AK353575.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1001C10.
GenBankAK3615332e-51AK361533.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1142P20.
GenBankJF9519492e-51JF951949.1 Triticum aestivum clone TaMYB66 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818980.11e-127probable transcription factor GLK2 isoform X3
SwissprotQ5NAN52e-96GLK2_ORYSJ; Probable transcription factor GLK2
TrEMBLA0A2T8IPG31e-128A0A2T8IPG3_9POAL; Uncharacterized protein
STRINGSi001336m1e-126(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-56GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]