PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00385.1.g00370.1.es.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 311aa    MW: 34600.2 Da    PI: 8.2243
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00385.1.g00370.1.es.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.63.4e-251431052
                          RWP-RK 10 lskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                                    l+k+F++++k+AAk Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Zpz_sc00385.1.g00370.1.es.mkhc  1 LRKHFAGSLKEAAKRLGVCPTTLKRICRQHGINRWPSRKIKKV 43
                                    789**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF020429.5E-24143IPR003035RWP-RK domain
PROSITE profilePS5151915.801163IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.3E-24210294No hitNo description
SuperFamilySSF542773.19E-22211294No hitNo description
SMARTSM006663.7E-22213296IPR000270PB1 domain
PROSITE profilePS5174520.817213296IPR000270PB1 domain
PfamPF005642.3E-16214295IPR000270PB1 domain
CDDcd064072.00E-41214294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
LRKHFAGSLK EAAKRLGVCP TTLKRICRQH GINRWPSRKI KKVGHSLKKL QMVIDSVHGA  60
EGTVQLSSLY ENFTKTSWSD RELQGDATYP LSEQNHHSEP SVLDQQCEGR FTSQTSGSNS  120
LSPSGSQSST SSHGCSSGSK SQQHISAPHL AIMQEVCMEE NQSSTLLRAS SHAEPHMLTE  180
ETPVTLFRSQ SPMLLSEKST EKVPGSQRSK PDSLKIKAMY GEERCIFRLQ PSWGFDKLKE  240
EIVRRFSIAK ETYVDLKYLD DESEWVLLTC DADLLECIDV YKSSSAQTVK ILVNRTVQTV  300
LAPSIGLTGL T
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00385.1.g00370.1.es.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.11e-165protein NLP1-like
SwissprotQ10S831e-148NLP1_ORYSJ; Protein NLP1
TrEMBLA0A3L6TQF21e-172A0A3L6TQF2_PANMI; Protein NLP1-like isoform X2
STRINGPavir.J25840.1.p1e-165(Panicum virgatum)
STRINGSi034133m1e-163(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.15e-72Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]