PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00379.1.g00400.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 450aa    MW: 48242.1 Da    PI: 8.0774
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00379.1.g00400.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40641631100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vh++FGasnv+k+l ++p+ er da+sslvyeA+ r+rdPvyG++g i+
  Zpz_sc00379.1.g00400.1.am.mk  64 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHRVFGASNVSKMLLEVPKPERADAASSLVYEANLRLRDPVYGCMGAIS 144
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lqqq++ l+ael+++++e
  Zpz_sc00379.1.g00400.1.am.mk 145 VLQQQVNALEAELDAVRAE 163
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.03863164IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4064161IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MQQTLISNNS ACWTSARERL DEIGKKIKRE TDATGIAASA STAPDENPVP RRLGLGGALN  60
TVTPCAACKL LRRRCAQECP FAPYFSPHEP HKFAAVHRVF GASNVSKMLL EVPKPERADA  120
ASSLVYEANL RLRDPVYGCM GAISVLQQQV NALEAELDAV RAEIFKHRYR QASAGGGAEL  180
TGDAAQATAS FVVPALAVHA GDVVSVAEAC QEVATPAGAP GMSPSSAVYV AEAVEQHSNT  240
TDHYSSLNTR QGGGGGGAFG GVACGVCMQL SSSYWLSSKQ AKSDIREERD GEAARLGWVL  300
LRLRGVAILM PRDLVRSAWC WLQTTAIYRW LGCLRPGAMA SHCCCTAVHL HERAASHGGG  360
AQLPDGFWSH RHGCPEFPAS RMRCASMLST FLTFTCFDWP TKGADFANLE MMHVVVAAAR  420
DLARCQCSAC PARVRVNTVL CFIVTDKCRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-406416711114LOB family transfactor Ramosa2.1
5ly0_B2e-406416711114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00379.1.g00400.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-122AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-103LOB domain-containing protein 15
TrEMBLA0A1E5VHX51e-114A0A1E5VHX5_9POAL; LOB domain-containing protein 15
STRINGSi004575m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-67LOB domain-containing protein 15