PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00375.1.g00250.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 285aa    MW: 30725.4 Da    PI: 8.1364
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00375.1.g00250.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.15.9e-2943111371
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl +a ++i++l+ ++++++ 
  Zpz_sc00375.1.g00250.1.am.mk  43 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLSAARHEIDKLPPLQFPPQD 111
                                   78*************************************************************999882 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.2E-2744105IPR005333Transcription factor, TCP
PROSITE profilePS5136929.70444102IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MISGSNRQAA DEEQARNHAA LASSRQWSAQ TESRIVRVSR VFGGKDRHSK VKTVKGLRDR  60
RVRLSVPTAI QLYDLQDRLG LNQPSKVVDW LLSAARHEID KLPPLQFPPQ DLMVGHLPAP  120
MPLMHEEKFD QLAAAAAALA RERAKAGHGD GAADAEGSGA HNMGRFPNIG YHHFMGLNSS  180
FAMVNSTMAY SNYSGEAWNI NMHENSAAGS PHVAAVATAA AAGAQHSSLL SLAPGPHQLV  240
FYPSEGDQQF QVDNLAGAQH SSLLSLAPVS HQLVFYPSEG DRSSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-2049103155Putative transcription factor PCF6
5zkt_B3e-2049103155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00008PBMTransfer from 496250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00375.1.g00250.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0855481e-113BT085548.1 Zea mays full-length cDNA clone ZM_BFc0031O04 mRNA, complete cds.
GenBankBT0858131e-113BT085813.1 Zea mays full-length cDNA clone ZM_BFc0067G09 mRNA, complete cds.
GenBankBT0862231e-113BT086223.1 Zea mays full-length cDNA clone ZM_BFc0133E08 mRNA, complete cds.
GenBankEU9702171e-113EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
GenBankKJ7280081e-113KJ728008.1 Zea mays clone pUT6143 TCP transcription factor (TCP30) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814168.11e-116transcription factor PCF5-like
RefseqXP_025814169.11e-116transcription factor PCF5-like
TrEMBLA0A3L6SMS61e-118A0A3L6SMS6_PANMI; Transcription factor PCF5-like
STRINGPavir.J15913.1.p1e-116(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5