PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00373.1.g00120.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23716.6 Da    PI: 9.0007
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00373.1.g00120.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.91.5e-241056248
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                                    rien   rqvtf+kRr+g+lKKA ELSvLCda + +iifs +gkly+
  Zpz_sc00373.1.g00120.1.sm.mkhc 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDAHIGIIIFSAHGKLYD 56
                                    8********************************************97 PP

2K-box35.44.6e-131201981390
                           K-box  13 kaeslqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                                      ++  +qe   L++ei+ Lq+ +R + G+  +  +s++eL++Le+ Le  +++iRs K+ +l++  e lq+k +e++++
  Zpz_sc00373.1.g00120.1.sm.mkhc 120 VTQDPKQETMVLQQEINLLQKGLRYIYGNRTNeHMSVEELNSLERYLEIWMNNIRSAKEGMLKAANEILQEKAQEVKNK 198
                                     568889**********************998626*****************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-24161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.52161IPR002100Transcription factor, MADS-box
CDDcd002658.08E-37294No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.096121207IPR002487Transcription factor, K-box
PfamPF014861.7E-13122198IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MARGKIQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD AHIGIIIFSA HGKLYDLATT  60
GYLCRLLCRA LLLASSTMEE LIERYKTASR EAQQGDGCGD QRMLQLSSLS LSLKSLAMYV  120
TQDPKQETMV LQQEINLLQK GLRYIYGNRT NEHMSVEELN SLERYLEIWM NNIRSAKEGM  180
LKAANEILQE KAQEVKNKGH FICIQED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-15160160MEF2C
5f28_B1e-15160160MEF2C
5f28_C1e-15160160MEF2C
5f28_D1e-15160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00373.1.g00120.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3704684e-63AK370468.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111D24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972486.11e-91MADS-box transcription factor 26
SwissprotA2YQK92e-87MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-87MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A3L6E6Z82e-91A0A3L6E6Z8_MAIZE; MADS-box transcription factor 26
STRINGSi014419m6e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.16e-45AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]