PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00360.1.g00240.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 337aa    MW: 33610.4 Da    PI: 7.3888
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00360.1.g00240.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57e-393492361
                        zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                   +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s
  Zpz_sc00360.1.g00240.1.sm.mk 34 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRS 92
                                  57899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-323190IPR003851Zinc finger, Dof-type
PfamPF027011.5E-333691IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3853791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MAGAGGATAV QQPSEGAGKS GTGAAGAPVV DPRAEALRCP RCDSANTKFC YYNNYSLSQP  60
RHFCKACKRY WTRGGTLRNV PVGGGCRKNK RSRTSAASAA GRTVSSAAAA GATSSSAASA  120
LSLPPPAGVS SSMQSLTSAL GLSGGTSLAS LLLGGGSGAD HLGLFQVAMQ SVVSDTTAYE  180
MQQQTQTQVD HLLGLGGYGS GAAGAQIQLK PWIQDSGAGA GGIMDTFYAP LLSSSVVPGL  240
EELHVKAEAA GAGEHQQAKV DAGAGDQNSW ELPTPSSTSN IDANIIASDA LMAAAAASMT  300
NNPAPSSFMY WGNGGIGGAA ASWPDLANCG SSIATLF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00360.1.g00240.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803596.11e-132dof zinc finger protein 2-like
TrEMBLA0A3L6T9P71e-135A0A3L6T9P7_PANMI; Dof zinc finger protein DOF5.1-like
STRINGSb02g034320.11e-125(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-33TARGET OF MONOPTEROS 6