PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00313.1.g00020.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 203aa    MW: 22467.3 Da    PI: 6.1288
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00313.1.g00020.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.16.1e-21145188245
                         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                                      r+r tpeLHe+Fvea++ LGGsekAtPk+i ++mkvkgLt++h
  Zpz_sc00313.1.g00020.1.sm.mkhc 145 LRMRRTPELHEQFVEAINMLGGSEKATPKAIQRVMKVKGLTIYH 188
                                     69*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF111071.9E-1410103No hitNo description
SuperFamilySSF466891.56E-7141189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-17143188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-12144187IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGWAHATVAM EELLGLVRGF VDILVLAGGR TSSGAAATWS CGEVKNALRW ALFFEEVFNN  60
LRDSGQYEDS ASELDAALVE LTSSQDFPKG LAGMRSDTLS SARDIDARSL TPRNYSYCQV  120
RSVSPFNYGE VSTDTLPSNT TPTKLRMRRT PELHEQFVEA INMLGGSEKA TPKAIQRVMK  180
VKGLTIYHKY RAIQHRPESS DED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-18144196260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00313.1.g00020.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954345.12e-52uncharacterized protein LOC101763564 isoform X3
TrEMBLA0A1E5V0194e-53A0A1E5V019_9POAL; Uncharacterized protein
STRINGPavir.Ab03274.1.p2e-51(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54942526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-22phosphate starvation response 1