PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00311.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 681aa    MW: 71351.8 Da    PI: 8.4881
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00311.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.41.2e-963146812374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                   ++lL e+A a+++g+ e a + La l+  a+p+gd  qRl+a+++ AL++r+a       ++ p+++ +e    e+ +  +
  Zpz_sc00311.1.g00090.1.am.mk 314 RQLLSEAAVAIADGNIETAATQLAALKRAANPRGDVEQRLIAMMVAALSSRIAP-----TASAPAQHLAELCGLEQRNGSQ 389
                                   789**************************************************9.....4455666666566778888889 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeele 159
                                    +++ sP+++++  +aN aI+eav  ++++H++Dfd+s + Q +aL+q La+R+ +  sl++T+v +p+s     ++ +l 
  Zpz_sc00311.1.g00090.1.am.mk 390 HLHDRSPCFRLALYAANVAIVEAVGDHRAIHVVDFDVSAP-QHAALIQYLAERRVPGTSLKVTAVTDPSSPftqsQTATLP 469
                                   9************************************987.99************************998889989999** PP

                          GRAS 160 etgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                                   ++gerL+k+A++ g++ +f++ v+ r ++l+  +L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l ++vv+
  Zpz_sc00311.1.g00090.1.am.mk 470 AVGERLKKLADRAGIEYHFKM-VSCRAAELDAAKLGLEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGAQVVT 549
                                   ********************9.7999******************************************************* PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   +veqe+++n++++++rf++a+ yy a++dslea+l+res er++ E + l++++ n+v  ega+r er+e ++kWr+r+++
  Zpz_sc00311.1.g00090.1.am.mk 550 LVEQELNTNTAPLAARFTDACAYYGAILDSLEATLGRESAERAMAESA-LAKKAANAVGREGADRLERCEVFGKWRARFGM 629
                                   ***********************************************9.9******************************* PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   aGF+pv+ls ++a+q+ + +   + +g++++ e+g l lgW++r ++++SaWr
  Zpz_sc00311.1.g00090.1.am.mk 630 AGFRPVALSPSIADQVVARVGPAP-QGFTMKPENGVLRLGWMGRVVTVASAWR 681
                                   ***********************9.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.193287662IPR005202Transcription factor GRAS
PfamPF035144.2E-94314681IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MPWGPAITPP DKHQRTHHHH SAAWATPSAG VPPNGVGSET AGAVSKHSSR RLPPSSRLPS  60
LSLPPCMEPG APWRDPRQGY AYGLGSAMQI PMQQQRPDAV GAGGVLKRSL GELERWQHQQ  120
VAAQQALYLR AVRQRTAAAA LLGGAPSHQP MVLPGSSYGG ALASPSSTLS SLSTASGAAV  180
PLMQPQMHRQ VPLMVSSAQQ TQALGVSRAP PPPPASSSDM FLLQELEKQL LGDDDEPVAA  240
MSGTGSAVTN SEWEETIQQL NSITAGASPV VPAPVTPNNN AAGMTRSPSN SSSSTASSSA  300
SCSPPTPGAA AATRQLLSEA AVAIADGNIE TAATQLAALK RAANPRGDVE QRLIAMMVAA  360
LSSRIAPTAS APAQHLAELC GLEQRNGSQH LHDRSPCFRL ALYAANVAIV EAVGDHRAIH  420
VVDFDVSAPQ HAALIQYLAE RRVPGTSLKV TAVTDPSSPF TQSQTATLPA VGERLKKLAD  480
RAGIEYHFKM VSCRAAELDA AKLGLEPGEA LAVNLAFALS HVPDESVSPA NPRDELLRRV  540
RALGAQVVTL VEQELNTNTA PLAARFTDAC AYYGAILDSL EATLGRESAE RAMAESALAK  600
KAANAVGREG ADRLERCEVF GKWRARFGMA GFRPVALSPS IADQVVARVG PAPQGFTMKP  660
ENGVLRLGWM GRVVTVASAW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3833268122375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.13e-84SCARECROW-like 8