PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00307.1.g00100.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 425aa    MW: 45320.6 Da    PI: 4.9843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00307.1.g00100.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81e-27189243156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  Zpz_sc00307.1.g00100.1.sm.mkhc 189 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 243
                                     6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.924186245IPR017930Myb domain
SuperFamilySSF466896.0E-19187246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-27187246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26189243IPR006447Myb domain, plants
PfamPF002495.7E-8192241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MLTVSPARCT GLEERAAAGG HASIGDVGME TEAIGAVSDL DFNFSVDDID FGDFFLRLED  60
DGDALPDLEV DPADIFTDFE EIAGGGNGVV EDQEVPTVHH PSPEVAHVDP CSGAGLAEEN  120
STAIADAEEG KGECNQHADE LVAAANNGDF AGSGTAAVAE EKSTSSTSSQ EAESRGHKSS  180
GKNSHGKKKA KVDWTPELHR RFVQAVEQLG IDKAVPSRIL EIMGIDSLTR HNIASHLQKY  240
RSHRKHMLAR EAEAASWTQR RQMYAAGAGA AAVKRPDSNA WTVPTIGFPP PPPPPASHPM  300
QQFGRPLHVW GHPTPTVDLP RVPMWPRHLV PRTPAPPWAP PPPPPSDPAA FWHHNPYMRG  360
HGHMPGQVIA MPMPAASSES IDAAIGDVLT EPWLPLPLGL KPPSVDSVMD ELQRQGVANV  420
PPACG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-17186241257ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. {ECO:0000269|PubMed:19808806}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00307.1.g00100.1.sm.mkhc
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812542.11e-163probable transcription factor GLK1
SwissprotQ5Z5I41e-141GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLA0A1E5VSE81e-172A0A1E5VSE8_9POAL; Putative transcription factor GLK1
STRINGSi006400m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.17e-56GOLDEN2-like 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang Y, et al.
    A highly efficient rice green tissue protoplast system for transient gene expression and studying light/chloroplast-related processes.
    Plant Methods, 2011. 7(1): p. 30
    [PMID:21961694]