PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00287.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 527aa    MW: 55702 Da    PI: 7.8288
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00287.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.51.2e-3176129357
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                                   +vrY+eClkNhAa++Gg a+DGCgEfmp+ geeg+ +al+C+ACgCHRnFHR+e+
  Zpz_sc00287.1.g00040.1.am.mk  76 GVRYRECLKNHAAAIGGSATDGCGEFMPA-GEEGSLDALRCSACGCHRNFHRKEP 129
                                   68**************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-2877129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-2978128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2278128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.68279128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MDFSGTQSEL PMPMGAGGPP YLGLQALHHA HEQQHNHGAN GRHMSPPQVE VEEEEDAKNR  60
QALAVVPVST GGGGGGVRYR ECLKNHAAAI GGSATDGCGE FMPAGEEGSL DALRCSACGC  120
HRNFHRKEPL GAGDGVPNRA LHHHHQLGLG GGPLHHPHPH HRGLLVAALP PAPTRMPQPE  180
LAAAAAAAAA PARVTNNSNS IDRASHLADD RFTSSWIHVA AAVVGSSYGN KSEATHYAQV  240
WVHSTTAAAR SARVPWSPCQ PLHPADNLLI WIITGANNHT SYFTEFTLVA LRNKDDRKDK  300
AGERRSTPAL LLSYSATHVV VCAPMAGRRV SASERDRQRR SLLRRLLSVN GAETELGKRA  360
VGQSRGMAGP GSCRGGSESE RDERGHVAAR SASPSEPAHA HAAELLKRPC GPWTAVCGAV  420
AGKASHQIQQ EYSSAHSGVR APAERSNDCR GSVCDLCPIA LLPPFLVDDD AKHTKGVKQG  480
NGGEGSHSLT PLPSTAELAM TQPAYDEQEP VNGLLNHSRS ESERGRG
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00287.1.g00040.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0432588e-82BT043258.1 Zea mays full-length cDNA clone ZM_BFc0135C02 mRNA, complete cds.
GenBankBT0650058e-82BT065005.1 Zea mays full-length cDNA clone ZM_BFc0120L10 mRNA, complete cds.
GenBankBT0655698e-82BT065569.1 Zea mays full-length cDNA clone ZM_BFb0298N18 mRNA, complete cds.
GenBankEU9655088e-82EU965508.1 Zea mays clone 286516 mRNA sequence.
GenBankJX4285008e-82JX428500.1 Zea mays subsp. mays clone pUT3098 ZHD21 ZF-HD type transcription factor mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2482823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-26homeobox protein 33