PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00279.1.g00400.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 451aa    MW: 48718 Da    PI: 10.3239
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00279.1.g00400.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-39210269261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Zpz_sc00279.1.g00400.1.am.mk 210 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 269
                                   7899******************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-31208268IPR003851Zinc finger, Dof-type
PfamPF027015.5E-33211268IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.227214268IPR003851Zinc finger, Dof-type
PROSITE patternPS013610216252IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MHGDQNIPRG STPPRLRRPD YALLREGPPA DKWARIGMRD APPRGTQGTK ASGPTAPEKP  60
TRRGEESGPS GPVRPTPARQ APRCYYALSR LRPLHGNFSV PSYSHLSPVR RSHRKSHANN  120
RHQQRHHTIV SSPFWLLARS SPTSSVSSIR RSMMAGAPPM HIYMDSDLFK GIIPEEPGLG  180
SSSPSTELIV CPRQMHPAAA VADRRLRPQH DQPLKCPRCE STHTKFCYYN NYSLSQPRYF  240
CKTCRRYWTK GGSLRNVPVG GGCRKNKRAN TKKQAAAAPP LLQGPARHVT ETDLHLSFSS  300
GMQQLPPTPA SVDPLSSFGL LDWTWKYDPM LAGSAGGAAA LDQSASSEAH FAGPGMTAGG  360
GGECHALSAL RYAAGLGEHL QALPPLLRSS HAENDAVDVK PAATDRLLSL EWYGEASRAP  420
ESAISSLGAL GLWSGMFGGA HQQHPGSSAA I
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00279.1.g00400.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1003501e-114FP100350.1 Phyllostachys edulis cDNA clone: bphylf036a01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001136632.11e-142Dof zinc finger protein DOF2.1
TrEMBLB6UAM81e-145B6UAM8_MAIZE; Uncharacterized protein
STRINGGRMZM2G140694_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.16e-36Dof family protein