PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00279.1.g00360.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 340aa    MW: 37656.6 Da    PI: 7.6394
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00279.1.g00360.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.32.1e-29154208359
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                   ++rY+eC++NhAa+lG+h++DGC+Efmps +e   ++al CaACgCHR+FHRre ++
  Zpz_sc00279.1.g00360.1.am.mk 154 QWRYRECQRNHAARLGAHVLDGCCEFMPSANE--GPDALACAACGCHRSFHRREASS 208
                                   789*************************9555..59*****************9875 PP

2Homeobox14.56.2e-05240296153
                                   TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                                   +r Rt+ft+eq +++ e+ +    + ++p+ ++     +++g++ r+ kvW +N + 
  Zpz_sc00279.1.g00360.1.am.mk 240 KRFRTKFTAEQKDRMREFAHrvgwRIHKPDYDAVDAFCAEVGVSRRVLKVWMHNNKH 296
                                   789***********987655888779****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.1E-25155206IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-15156208IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-24156205IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.448157205IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.4E-30231298IPR009057Homeodomain-like
SuperFamilySSF466891.26E-19233297IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-27239295IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEYKGSSHVE EEEDDMDEEE EEDDEEENRG RRYTTAPAAP VGAPQPQVVH GQAHGLLGSH  60
SSVTTESQSA AFSRPLLPPN SSLVSSQLPP PPGFLQPQRQ PQQAHPRKPE RGGGTQAQHQ  120
QVRLQQELAR NGTTPTPPSA STLALTTGAV VQPQWRYREC QRNHAARLGA HVLDGCCEFM  180
PSANEGPDAL ACAACGCHRS FHRREASSSE ELRGSAPARP LPPPQLAVGS ASAPPAPSKK  240
RFRTKFTAEQ KDRMREFAHR VGWRIHKPDY DAVDAFCAEV GVSRRVLKVW MHNNKHLAKM  300
PPHSPSSGQQ QPAPSHHHHH HHDHHHYPPP HQHHQQQHNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-212383081680ZF-HD homeobox family protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00279.1.g00360.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567597e-75EU956759.1 Zea mays clone 1572892 zinc finger homeodomain protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLF2D2985e-50F2D298_HORVV; Predicted protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-42homeobox protein 22