PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00275.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 701aa    MW: 75360.1 Da    PI: 10.4228
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00275.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.32.6e-07331368440
                      zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40 
                                   r+C  ++  ++  +C++++ +lC  C  + H +  H++v
  Zpz_sc00275.1.g00140.1.am.mk 331 RRCGACGGTPAAVHCRTDGAYLCIACDAA-HARagHERV 368
                                   79***************************.977889875 PP

2CCT69.86.7e-24610653144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k++
  Zpz_sc00275.1.g00140.1.am.mk 610 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRT 653
                                   9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.186328370IPR000315B-box-type zinc finger
SMARTSM003361.6E-5328370IPR000315B-box-type zinc finger
PfamPF006432.1E-5331368IPR000315B-box-type zinc finger
CDDcd000219.36E-4340370No hitNo description
PROSITE profilePS5101716.956610652IPR010402CCT domain
PfamPF062031.0E-17610652IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MVCHHPFAPQ QRPRIPWPSV FSGHRTRGAR KVHVHRTGHV DRWTTPVLVV GARRTHEYNA  60
PPAKLDADAK AGRYRDPPQG ARDVGVSLAA RPIISIASTC PGWVRHYLHP DRTRYSSILH  120
DVPDRCSGAR LCHQLLDPPS KTTHRDRSIV TALYLARSGK GHRHMAPRIA AVLAVPVAPR  180
DMTASRSSSA PSVPSRIDDG SAPQGVLAFG GGSRDLTQSL LIGSARRPAA DMGTSARDAR  240
QHPIGLLFSR EICSPLSLPP LGRKPRLGGW VPMASHDPAS TSHHHHHHYL SKKIHEPAGW  300
KKQAAGGGRA LREETMEAAA QLGRYWGVGG RRCGACGGTP AAVHCRTDGA YLCIACDAAH  360
ARAGHERVWV CEPIGSAASA AADVDALLFG TEAGMVLGGA GDPKQDAKMD FLFVDVMDPF  420
LGPEVARFPQ ADSVLPNTNN GSGGGAVELD FGGVVAAKAK PSYSSYTAAS LGHSGSSSEV  480
GLVPDTICGR GGSVTGGVIE LDFAQSKAAY LPYGTTPKHN VSSVDAGAVP ERIDGVTAGR  540
VPTPATAESR EARLMRYREK RKNRRTNQNR SILILFLRQK VSSVDAGAVP ERIDGVTAGR  600
VPTPATAESR EARLMRYREK RKNRRFEKTI RYASRKAYAE TRPRVKGRFA KRTDDNETDA  660
DADANTAAVA PSAPQRQRQQ KPHSYPYVFD FSGGYGAVPS F
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00275.1.g00140.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0963183e-51FP096318.1 Phyllostachys edulis cDNA clone: bphylf059i05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818683.12e-92zinc finger protein CONSTANS-like
TrEMBLA0A3L6QHQ51e-104A0A3L6QHQ5_PANMI; Zinc finger protein CONSTANS-LIKE 5-like
STRINGPavir.Aa03360.1.p2e-90(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-21CONSTANS-like 3