PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00257.1.g00240.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 274aa    MW: 29075.6 Da    PI: 7.9552
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00257.1.g00240.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.62e-29501473103
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+ +a+++i++l+ ++++++++   ++ +   +
  Zpz_sc00257.1.g00240.1.am.mk  50 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDAAQHEIDKLPPLQFPPQHA---QDLVAHLQ 127
                                   78*************************************************************9999933...34444444 PP

                           TCP  84 nsssgkaaksaakskksqks 103
                                    ss+ +  +s+a   ++ + 
  Zpz_sc00257.1.g00240.1.am.mk 128 PSSILAPFTSTAAADSAATA 147
                                   44444333333333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-2651122IPR005333Transcription factor, TCP
PROSITE profilePS5136929.40251109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MISGNHTNEE LASCRKAEQP AGAGKSAVAS SRHWPPSTES RIVRVSRVFG GKDRHSKVRT  60
VKGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLID AAQHEIDKLP PLQFPPQHAQ  120
DLVAHLQPSS ILAPFTSTAA ADSAATAASS MLDGDKGGGI KGLMGLNNSV SLVNGAMPLA  180
HGLYFAGESW TNGVSVHDQV SHGNSPQPTV AHHSPFSSLL SLAPGPQLVF YSPEGGGFAM  240
KEAQDQFPVD NLEHSQGQLS LSSARSFLHS GSQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2056110155Putative transcription factor PCF6
5zkt_B2e-2056110155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00257.1.g00240.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0366941e-122BT036694.1 Zea mays full-length cDNA clone ZM_BFb0132C18 mRNA, complete cds.
GenBankBT0689421e-122BT068942.2 Zea mays full-length cDNA clone ZM_BFc0170I14 mRNA, complete cds.
GenBankBT0692791e-122BT069279.2 Zea mays full-length cDNA clone ZM_BFc0043P12 mRNA, complete cds.
GenBankEU9678771e-122EU967877.1 Zea mays clone 306784 hypothetical protein mRNA, complete cds.
GenBankKJ7268261e-122KJ726826.1 Zea mays clone pUT3365 TCP transcription factor (TCP7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-146transcription factor TCP13 isoform X1
RefseqXP_004961522.11e-146transcription factor TCP13 isoform X1
RefseqXP_012700333.11e-146transcription factor TCP13 isoform X1
TrEMBLK3Z8G31e-144K3Z8G3_SETIT; Uncharacterized protein
STRINGSi022830m1e-145(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5