PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00257.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 578aa    MW: 61831.6 Da    PI: 9.9526
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00257.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof103.99e-331021501260
                        zf-Dof  12 dstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                    s +tkfCy+nny+++qPr+fC+aC+ryWt+GGalrnvPvG+grrkn++
  Zpz_sc00257.1.g00140.1.am.mk 102 GSVDTKFCYFNNYNVNQPRHFCRACHRYWTAGGALRNVPVGSGRRKNRA 150
                                   589********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088423.58996150IPR003851Zinc finger, Dof-type
PfamPF027012.9E-26103149IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-22103149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MRSLRHGFAP GLDRKGVTRT GTFWLDRFAR KRIESVMAST ENTHKLIGID RDMLSHVETP  60
GAGAAGIKLF GKVITTQPQQ PAHRSAALPA PPRQVPQASG RGSVDTKFCY FNNYNVNQPR  120
HFCRACHRYW TAGGALRNVP VGSGRRKNRA MLPSSAHVAT ATASDDQGSG SSGSTPMFST  180
APAGFFALYH DASSHITVPP AAYNAAGVTE TTELWRWHVT STAERSGPMG QENAAASFCG  240
SFGRVVATMM LGHMAANGRK GASKFEDSSS DSSMPRPRYS TAPQAASEVP QRPAPRLKAA  300
AGSESTGGAP RRPVVVRGTT APRSPLHEAR MEKKPPVGGG GAGAGSRVVE LEAKLEKAHG  360
QLTEMREQLT AAEKARKEAR AALVEAKKRL AAKKRDDLGA AASAVQGGDG HNKALAAVAA  420
AVGYDEKAGM IASDTDVLDA VVSSEPENNN VEPKAKNTTD DEKMWRQEVD ELSAKLMAKD  480
REVYELRTKL TMRDTEADEL RETLTAKNIE LDELERKLAS TDAEINKLTA SLTAKDADIA  540
ALEADNAELT KMAEEAGEAR KPGATRALSD LWKKKAQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00257.1.g00140.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9550114e-53EU955011.1 Zea mays clone 1501573 hypothetical protein mRNA, complete cds.
GenBankKJ7269954e-53KJ726995.1 Zea mays clone pUT3967 C2C2-DOF transcription factor (DOF10) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963662.28e-76interactor of constitutive active ROPs 1
TrEMBLK3Z6A42e-74K3Z6A4_SETIT; Uncharacterized protein
STRINGSi022073m3e-75(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1003322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.17e-28Dof family protein