PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00235.1.g00380.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 356aa    MW: 37630.2 Da    PI: 9.8535
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00235.1.g00380.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-39127186362
                        zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                    +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+ss
  Zpz_sc00235.1.g00380.1.am.mk 127 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRSS 186
                                   5789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29118179IPR003851Zinc finger, Dof-type
PfamPF027013.4E-33129184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.329130184IPR003851Zinc finger, Dof-type
PROSITE patternPS013610132168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MNHAALPSFT SGDLDASSRA VHTYAYMKAT EGGIRDKPTE IFTGWLVCDP EATPSGWSSR  60
LAVLPPTKRY LARRRRLRLL PRAMQEFQSI PGLARRLFGG AGASDLRRAH QAQQGPGARC  120
GGVSPAPEAV KCPRCESTNT KFCYYNNYNL SQPRHFCKSC RRYWTKGGVL RNVPVGGGCR  180
KAKRSSASAA SSTPSTPTST ESKNPRRAPA PSPRRTSSGR SSPTGLAAAA APVTPSSSNN  240
IAVTGHSSAN PFSTVDVAPP APIFADQAAA LASLFTPPPP PQLPVFSFTA QSNKDEAALV  300
AGQAARPDDE AASDMAPFTS LDAGIFEQLG DASAAAAYWN AGSCWTDVQD PSMYLP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00235.1.g00380.1.am.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281321e-92AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610001e-92AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008921e-92AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013211e-92AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052841e-92AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149581e-92AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-92CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822624.11e-111dof zinc finger protein 4-like
SwissprotQ6Z3452e-97DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBLA0A2S3GST51e-110A0A2S3GST5_9POAL; Uncharacterized protein
STRINGSb04g029300.11e-96(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-30DOF zinc finger protein 1
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]