PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00220.1.g00050.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 215aa    MW: 23133.7 Da    PI: 9.5947
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00220.1.g00050.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.32.3e-1541712555
                         G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    ++A+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Zpz_sc00220.1.g00050.1.sm.mkhc 41 DEAVPKKILELMNVPGLTRENVASHLQKFRL 71
                                    78****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.8E-51540No hitNo description
SuperFamilySSF466891.97E-93575IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-134171IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-154176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MAAAAQARGG EFPVGMKVLV VDDDPTCLLV LKKMLDECKY DEAVPKKILE LMNVPGLTRE  60
NVASHLQKFR LYLKRIAQHH AGIAHPFAPS ASSAKVAPLG GFDLQALAAS GQIPQALAAL  120
QDELLGRPTS SLPLPGRDQS SLRLAAIKGN KPHGEREIAF GQPIYKCQNN AYGNAMGVSS  180
KPQVVLKTES SDSLRHSYGY VSGSAGLIRE HWKQI
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00220.1.g00050.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0601301e-129AB060130.1 Zea mays ZmRR8 mRNA for response regulator 8, complete cds.
GenBankEU9755451e-129EU975545.1 Zea mays clone 492147 two-component response regulator ARR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001104861.23e-77response regulator 8
RefseqXP_008648025.11e-77response regulator 8 isoform X1
SwissprotA2XE312e-76ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S72e-76ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLQ9AV935e-76Q9AV93_MAIZE; Two-component response regulator
STRINGGRMZM2G099797_P011e-76(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57963754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-28response regulator 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]