PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00188.1.g00220.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 238aa    MW: 26376.7 Da    PI: 7.0183
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00188.1.g00220.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH51.61.6e-1665117155
                                     CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                             HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                                     r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ +A++YI +Lq
  Zpz_sc00188.1.g00220.1.sm.mkhc  65 RKLSHNAYERDRRKQLNELYSSLRSLLPDA--DHTKKLSIPTTVSQAIRYIPELQ 117
                                     6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474597.07E-1862131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088815.18664116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.25E-1364121No hitNo description
PfamPF000101.4E-1365117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.1E-1465131IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.5E-1270122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MNHRQFNDPF ASSNISSLEG DIFSGGQLSS PAWPDFDLDD DYVVQDTSPP VANGATSSGG  60
SGTNRKLSHN AYERDRRKQL NELYSSLRSL LPDADHTKKL SIPTTVSQAI RYIPELQKQV  120
EDLERKKKDL TSANCNPGVL KTRESVTPLV SATCLNDIEI MVQVGLPTNL AVTTLPLSKC  180
IKLLENEGVQ LISSSTHSTF ENMTFYSLHL QRSKRTMNKE CPAFCDELER SIRKKAGA
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00188.1.g00220.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8335979e-56CT833597.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA113H03, full insert sequence.
GenBankCT8335989e-56CT833598.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA042K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021313618.11e-117transcription factor bHLH101-like
SwissprotA2WZ602e-97IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2
TrEMBLA0A1B6Q8941e-115A0A1B6Q894_SORBI; Uncharacterized protein
STRINGSb03g046090.11e-116(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.19e-30bHLH family protein