PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00187.1.g00230.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 583aa    MW: 64096.4 Da    PI: 11.3355
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00187.1.g00230.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.31.7e-33209263559
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                   + ++ r  ++ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+
  Zpz_sc00187.1.g00230.1.am.mk 209 QPTVKREAARNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNR 263
                                   556788899********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088424.288210264IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-19214263IPR003851Zinc finger, Dof-type
PfamPF027011.1E-25216263IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MPRSWPWLRK ASRTSTPRQV FMGFFPHLKE TTQPCYQVHS LPNLLAAGMD TASQQCLYKN  60
GEILLESQTP HTPPPSSSST SAREPSAAIT ITLNKLVLLG RRRERNRPRI VSDSFRRRRT  120
FLPLPRFLPA AQPIFSFGSC ACLLPRPISW PRPPRFVVWM LSHVETARGA GGIKLFGKVI  180
TQCAAPAPSQ EDPASRAAFV RERPDESEQP TVKREAARNT KFCYFNNYNV NQPRHFCKDC  240
HRYWTAGGAL RNVPVGAGRR KNRPLGPVVA AHHANHHQLH HHHHPAAAAA GLVLGFPGDP  300
SSLASPVYAD RWPVCPERRA SAVSVPVRGQ PSLRLGRGPD EQAASSPFGK RHHQILQTSD  360
DPNAHSTISC GSPECQRDPM PARRHSRIYF DCAVPTSMTV GKKRLATWAR AHFPAARASA  420
FGPDFTAAGR PGAIVVGSCA AGAGREGTFW LCCLLDWTGR REQAARKLCH GSDLLLAGIT  480
LDTKSWCVKR AGRLPGGVNF IAKTRWFVPR RYRCTLSTRA VASVVALAVP SHSRPAAFPQ  540
KRRKRTGGTT RPLASAELQA PVESINPDGA WKHGTRHGTS YCA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100118RRRERNRPRIVSDSFRRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc00187.1.g00230.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3937182e-64JN393718.1 Sorghum bicolor clone Sbdof12 Dof (Dof) gene, partial cds.
GenBankKC5824092e-64KC582409.1 Sorghum bicolor dof12 protein (dof12) gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.18e-30Dof family protein